PTPA (protein phosphatase 2 phosphatase activator)

Gene

• Entrez ID: 5524
• Gene name: Protein phosphatase 2 phosphatase activator
• Gene symbol: PTPA
• Synonyms (NCBI Gene): PARK25, PP2A, PPP2R4, PR53
• Chromosome: 9
• Chromosome location: 9q34.11
• Summary: Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438392	hsa-miR-183-5p	Luciferase reporter assay, Western blot, qRT-PCR	25152390
MIRT438392	hsa-miR-183-5p	Luciferase reporter assay, Western blot, qRT-PCR	25152390

Transcription factors

Transcription factor	Regulation	Reference
HDAC4	Unknown	18045992
SETBP1	Repression	21233840
TP53	Repression	10787423

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	IBA
GO:0000159	Component	Protein phosphatase type 2A complex	IDA	10318862
GO:0000166	Function	Nucleotide binding	IEA
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IBA
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IDA	16916641
GO:0005102	Function	Signaling receptor binding	IPI	10830164
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 33961781
GO:0005524	Function	ATP binding	IDA	16916641
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17333320
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17333320
GO:0005737	Component	Cytoplasm	IEA
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0008160	Function	Protein tyrosine phosphatase activator activity	IBA
GO:0008160	Function	Protein tyrosine phosphatase activator activity	IDA	16916641
GO:0008160	Function	Protein tyrosine phosphatase activator activity	TAS	8195217
GO:0016853	Function	Isomerase activity	IEA
GO:0019211	Function	Phosphatase activator activity	IEA
GO:0019888	Function	Protein phosphatase regulator activity	IDA	16916641
GO:0019888	Function	Protein phosphatase regulator activity	TAS	10318862
GO:0019902	Function	Phosphatase binding	IDA	16916641
GO:0034704	Component	Calcium channel complex	IDA	10830164
GO:0042803	Function	Protein homodimerization activity	IDA	16916641
GO:0043065	Process	Positive regulation of apoptotic process	IDA	17333320
GO:0046872	Function	Metal ion binding	IEA
GO:0051721	Function	Protein phosphatase 2A binding	IDA	16916641
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1904949	Component	ATPase complex	IDA	16916641

Other IDs

• MIM: 600756
• HGNC: 9308
• e!Ensembl: ENSG00000119383

Protein

• UniProt ID: Q15257
• Protein name: Serine/threonine-protein phosphatase 2A activator (EC 5.2.1.8) (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA) (Serine/threonine-protein phosphatase 2A regulatory subunit 4) (Serine/threonine-protein phosphatase 2A regulator
• Protein function: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Acts as a regulatory subunit for serine/threonine-protein phosphatase 2A (PP2A) (PubMed:169166
• PDB: 2G62, 2HV6, 2HV7, 2IXM, 4LAC, 4NY3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03095	PTPA	26 → 352	Phosphotyrosyl phosphate activator (PTPA) protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed.
• Sequence:

  MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVK
  GKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLD
  RWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGN
  STRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAG
  SQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKT
  GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG

• Sequence length: 358

Pathways

KEGG:

Insulin resistance
Diabetic cardiomyopathy

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Parkinson disease 25, autosomal recessive early-onset, with impaired intellectual development	Pathogenic	rs1564202579, rs2490999610	RCV003323317 RCV003323318	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL MUCINOUS ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 2	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations