Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55233
Gene name	MOB kinase activator 1A
Gene symbol	MOB1A
Synonyms (NCBI Gene)	C2orf6MABKL1BMATS1MOB1MOBK1BMOBKL1BMob4B
Chromosome	2
Chromosome location	2p13.1
Summary	The protein encoded by this gene is a component of the Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also

Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021885	hsa-miR-128-3p	Microarray	17612493
MIRT025110	hsa-miR-181a-5p	Sequencing	20371350
MIRT032205	hsa-let-7b-5p	Proteomics	18668040
MIRT048766	hsa-miR-93-5p	CLASH	23622248
MIRT630417	hsa-miR-1295b-3p	HITS-CLIP	23824327
MIRT630416	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT630415	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT630414	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT630413	hsa-miR-564	HITS-CLIP	23824327
MIRT630412	hsa-miR-4284	HITS-CLIP	23824327
MIRT630411	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT630410	hsa-miR-1295a	HITS-CLIP	23824327
MIRT630409	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT560158	hsa-miR-3617-5p	PAR-CLIP	20371350
MIRT560157	hsa-miR-641	PAR-CLIP	20371350
MIRT560155	hsa-miR-5197-3p	PAR-CLIP	20371350
MIRT560156	hsa-miR-3682-5p	PAR-CLIP	20371350
MIRT547394	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT547393	hsa-miR-3646	PAR-CLIP	21572407
MIRT547392	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT207300	hsa-miR-3606-3p	PAR-CLIP	21572407
MIRT207298	hsa-miR-513a-3p	PAR-CLIP	21572407
MIRT207299	hsa-miR-513c-3p	PAR-CLIP	21572407
MIRT547391	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT547390	hsa-miR-4513	PAR-CLIP	21572407
MIRT547389	hsa-miR-6855-3p	PAR-CLIP	21572407
MIRT547388	hsa-miR-6857-3p	PAR-CLIP	21572407
MIRT547387	hsa-miR-548v	PAR-CLIP	21572407
MIRT547386	hsa-miR-3136-5p	PAR-CLIP	21572407
MIRT547385	hsa-miR-4439	PAR-CLIP	21572407
MIRT547394	hsa-miR-186-5p	Luciferase reporter assayWestern blottingRNA-seqqRT-PCR	33413543
MIRT630417	hsa-miR-1295b-3p	HITS-CLIP	23824327
MIRT630416	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT630415	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT630414	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT630413	hsa-miR-564	HITS-CLIP	23824327
MIRT630412	hsa-miR-4284	HITS-CLIP	23824327
MIRT630411	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT630410	hsa-miR-1295a	HITS-CLIP	23824327
MIRT630409	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT560158	hsa-miR-3617-5p	PAR-CLIP	20371350
MIRT560157	hsa-miR-641	PAR-CLIP	20371350
MIRT560155	hsa-miR-5197-3p	PAR-CLIP	20371350
MIRT560156	hsa-miR-3682-5p	PAR-CLIP	20371350
MIRT547394	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT547393	hsa-miR-3646	PAR-CLIP	21572407
MIRT547392	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT207300	hsa-miR-3606-3p	PAR-CLIP	21572407
MIRT207298	hsa-miR-513a-3p	PAR-CLIP	21572407
MIRT207299	hsa-miR-513c-3p	PAR-CLIP	21572407
MIRT547391	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT547390	hsa-miR-4513	PAR-CLIP	21572407
MIRT547389	hsa-miR-6855-3p	PAR-CLIP	21572407
MIRT547388	hsa-miR-6857-3p	PAR-CLIP	21572407
MIRT547387	hsa-miR-548v	PAR-CLIP	21572407
MIRT547386	hsa-miR-3136-5p	PAR-CLIP	21572407
MIRT547385	hsa-miR-4439	PAR-CLIP	21572407

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15197186, 16189514, 18362890, 18985028, 19739119, 21516123, 23386615, 23972470, 24255178, 24366813, 25416956, 25852190, 28514442, 30212651, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18328708
GO:0005829	Component	Cytosol	TAS
GO:0030295	Function	Protein kinase activator activity	IBA
GO:0035329	Process	Hippo signaling	IBA
GO:0035329	Process	Hippo signaling	IDA	35429439
GO:0035329	Process	Hippo signaling	IDA	18328708, 19739119
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	18328708
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337

MIM	HGNC	e!Ensembl
609281	16015	ENSG00000114978

Q9H8S9

Protein name

MOB kinase activator 1A (Mob1 alpha) (Mob1A) (Mob1 homolog 1B) (Mps one binder kinase activator-like 1B)

Protein function

Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK

PDB

1PI1 , 4J1V , 4JIZ , 5BRK , 5BRM , 5TWF , 5TWG , 5TWH , 5XQZ , 6MCP , 6MCQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03637	Mob1_phocein	33 → 204	Mob1/phocein family	Family

Tissue specificity

TISSUE SPECIFICITY: Adrenal gland, bone marrow, brain, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, heart, spinal cord, fetal brain and fetal liver. {ECO:0000269|PubMed:19739119}.

Sequence

MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVN
TVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMT
WVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLN
TSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR

Sequence length

216

Interactions

View interactions

	KEGG		Reactome
	Hippo signaling pathway Hippo signaling pathway - multiple species		Signaling by Hippo

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	34983617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17311693, 28346423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17611689, 9129152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17611689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28448997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	17311693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17311693, 28346423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17311693, 23143302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17611689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	23143302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15766530, 17611689, 18171988, 28947795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17311693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	9169130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38169377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36943460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30072378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31825843		★★★★★ ★☆☆☆☆ Found in Text Mining only

MOB1A (MOB kinase activator 1A)