Gene Gene information from NCBI Gene database.
Entrez ID 55224
Gene name Ethanolamine kinase 2
Gene symbol ETNK2
Synonyms (NCBI Gene)
EKI2HMFT1716
Chromosome 1
Chromosome location 1q32.1
Summary The protein encoded by this gene is a member of choline/ethanolamine kinase family which catalyzes the first step of phosphatidylethanolamine (PtdEtn) biosynthesis via the cytidine diphosphate (CDP) ethanolamine pathway. Alternative splicing results in mu
miRNA miRNA information provided by mirtarbase database.
167
miRTarBase ID miRNA Experiments Reference
MIRT021559 hsa-miR-142-3p Microarray 17612493
MIRT021789 hsa-miR-132-3p Microarray 17612493
MIRT437580 hsa-miR-125a-5p MicroarrayqRT-PCR 22815788
MIRT437645 hsa-miR-155-5p MicroarrayqRT-PCR 22815788
MIRT439163 hsa-let-7c-5p 3'LIFE 25074381
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
CTCF Unknown 18632798
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001701 Process In utero embryonic development IEA
GO:0001890 Process Placenta development IEA
GO:0004305 Function Ethanolamine kinase activity IBA
GO:0004305 Function Ethanolamine kinase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609859 25575 ENSG00000143845
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NVF9
Protein name Ethanolamine kinase 2 (EKI 2) (EC 2.7.1.82) (Ethanolamine kinase-like protein)
Protein function Highly specific for ethanolamine phosphorylation. Does not have choline kinase activity (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01633 Choline_kinase 105 307 Family
Tissue specificity TISSUE SPECIFICITY: Expressed in kidney, liver, ovary, testis and prostate. {ECO:0000269|PubMed:11044454}.
Sequence
MAVPPSAPQPRASFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDP
DDILPGALRLIQELRPHWKPEQVRTKRFTDGITNKLVACYVEEDMQDCVLVRVYGERTEL
LVDRENEVRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMA
KIHTIHANGSLPKPILWHKMHNYFTLVKNEINPSLSADVPKVEVLERELAWLKEHLSQLE
SPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFDIGNHFNEFAGVNEVDYCLYP
ARETQLQ
WLHYYLQAQKGMAVTPREVQRLYVQVNKFALASHFFWALWALIQNQYSTIDFD
FLRYAVIRFNQYFKVKPQASALEMPK
Sequence length 386
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycerophospholipid metabolism
Metabolic pathways
  Synthesis of PE
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PERIODONTITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Laryngeal Neoplasms Laryngeal neoplasm Pubtator 25719218 Associate
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 33408336 Associate
★☆☆☆☆
Found in Text Mining only