Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55200
Gene name	Pleckstrin homology and RhoGEF domain containing G6
Gene symbol	PLEKHG6
Synonyms (NCBI Gene)	ARHGEF46MyoGEF
Chromosome	12
Chromosome location	12p13.31

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments
MIRT1242059	hsa-miR-185	CLIP-seq
MIRT1242060	hsa-miR-3150a-3p	CLIP-seq
MIRT1242061	hsa-miR-3175	CLIP-seq
MIRT1242062	hsa-miR-3192	CLIP-seq
MIRT1242063	hsa-miR-326	CLIP-seq
MIRT1242064	hsa-miR-330-5p	CLIP-seq
MIRT1242065	hsa-miR-3927	CLIP-seq
MIRT1242066	hsa-miR-4279	CLIP-seq
MIRT1242067	hsa-miR-4306	CLIP-seq
MIRT1242068	hsa-miR-4314	CLIP-seq
MIRT1242069	hsa-miR-4451	CLIP-seq
MIRT1242070	hsa-miR-4644	CLIP-seq
MIRT1242071	hsa-miR-4646-5p	CLIP-seq
MIRT1242072	hsa-miR-4667-5p	CLIP-seq
MIRT1242073	hsa-miR-4700-5p	CLIP-seq
MIRT1242074	hsa-miR-634	CLIP-seq
MIRT1242075	hsa-miR-939	CLIP-seq
MIRT2298551	hsa-let-7a	CLIP-seq
MIRT2298552	hsa-let-7b	CLIP-seq
MIRT2298553	hsa-let-7c	CLIP-seq
MIRT2298554	hsa-let-7d	CLIP-seq
MIRT2298555	hsa-let-7e	CLIP-seq
MIRT2298556	hsa-let-7f	CLIP-seq
MIRT2298557	hsa-let-7g	CLIP-seq
MIRT2298558	hsa-let-7i	CLIP-seq
MIRT2298559	hsa-miR-106a	CLIP-seq
MIRT2298560	hsa-miR-106b	CLIP-seq
MIRT2298561	hsa-miR-1224-3p	CLIP-seq
MIRT2298562	hsa-miR-1260	CLIP-seq
MIRT2298563	hsa-miR-1260b	CLIP-seq
MIRT2298564	hsa-miR-1280	CLIP-seq
MIRT2298565	hsa-miR-1299	CLIP-seq
MIRT2298566	hsa-miR-1343	CLIP-seq
MIRT2298567	hsa-miR-150	CLIP-seq
MIRT2298568	hsa-miR-17	CLIP-seq
MIRT1242059	hsa-miR-185	CLIP-seq
MIRT2298569	hsa-miR-202	CLIP-seq
MIRT2298570	hsa-miR-20a	CLIP-seq
MIRT2298571	hsa-miR-20b	CLIP-seq
MIRT2298572	hsa-miR-302a	CLIP-seq
MIRT2298573	hsa-miR-302b	CLIP-seq
MIRT2298574	hsa-miR-302c	CLIP-seq
MIRT2298575	hsa-miR-302d	CLIP-seq
MIRT2298576	hsa-miR-302e	CLIP-seq
MIRT1242060	hsa-miR-3150a-3p	CLIP-seq
MIRT2298577	hsa-miR-3153	CLIP-seq
MIRT1242061	hsa-miR-3175	CLIP-seq
MIRT1242062	hsa-miR-3192	CLIP-seq
MIRT1242063	hsa-miR-326	CLIP-seq
MIRT1242064	hsa-miR-330-5p	CLIP-seq
MIRT2298578	hsa-miR-3663-5p	CLIP-seq
MIRT2298579	hsa-miR-372	CLIP-seq
MIRT2298580	hsa-miR-373	CLIP-seq
MIRT2298581	hsa-miR-378g	CLIP-seq
MIRT1242065	hsa-miR-3927	CLIP-seq
MIRT1242066	hsa-miR-4279	CLIP-seq
MIRT1242067	hsa-miR-4306	CLIP-seq
MIRT1242068	hsa-miR-4314	CLIP-seq
MIRT2298582	hsa-miR-4437	CLIP-seq
MIRT2298583	hsa-miR-4438	CLIP-seq
MIRT2298584	hsa-miR-4446-5p	CLIP-seq
MIRT1242069	hsa-miR-4451	CLIP-seq
MIRT2298585	hsa-miR-4458	CLIP-seq
MIRT2298586	hsa-miR-4500	CLIP-seq
MIRT2298587	hsa-miR-4514	CLIP-seq
MIRT2298588	hsa-miR-4527	CLIP-seq
MIRT1242070	hsa-miR-4644	CLIP-seq
MIRT1242071	hsa-miR-4646-5p	CLIP-seq
MIRT1242072	hsa-miR-4667-5p	CLIP-seq
MIRT2298589	hsa-miR-4668-5p	CLIP-seq
MIRT2298590	hsa-miR-4674	CLIP-seq
MIRT2298591	hsa-miR-4692	CLIP-seq
MIRT1242073	hsa-miR-4700-5p	CLIP-seq
MIRT2298592	hsa-miR-4708-5p	CLIP-seq
MIRT2298593	hsa-miR-4713-3p	CLIP-seq
MIRT2298594	hsa-miR-4731-5p	CLIP-seq
MIRT2298595	hsa-miR-4755-5p	CLIP-seq
MIRT2298596	hsa-miR-5095	CLIP-seq
MIRT2298597	hsa-miR-512-3p	CLIP-seq
MIRT2298598	hsa-miR-519d	CLIP-seq
MIRT2298599	hsa-miR-520a-3p	CLIP-seq
MIRT2298600	hsa-miR-520b	CLIP-seq
MIRT2298601	hsa-miR-520c-3p	CLIP-seq
MIRT2298602	hsa-miR-520d-3p	CLIP-seq
MIRT2298603	hsa-miR-520e	CLIP-seq
MIRT2298604	hsa-miR-520g	CLIP-seq
MIRT2298605	hsa-miR-520h	CLIP-seq
MIRT2298606	hsa-miR-532-3p	CLIP-seq
MIRT2298607	hsa-miR-548u	CLIP-seq
MIRT1242074	hsa-miR-634	CLIP-seq
MIRT2298608	hsa-miR-875-3p	CLIP-seq
MIRT2298609	hsa-miR-93	CLIP-seq
MIRT1242075	hsa-miR-939	CLIP-seq
MIRT2298610	hsa-miR-98	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000922	Component	Spindle pole	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	19129481, 25416956, 31515488, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005902	Component	Microvillus	IEA
GO:0030054	Component	Cell junction	IDA
GO:0032154	Component	Cleavage furrow	IEA
GO:0042995	Component	Cell projection	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS

MIM	HGNC	e!Ensembl
611743	25562	ENSG00000008323

Q3KR16

Protein name

Pleckstrin homology domain-containing family G member 6 (PH domain-containing family G member 6) (Myosin-interacting guanine nucleotide exchange factor) (MyoGEF)

Protein function

Guanine nucleotide exchange factor activating the small GTPase RHOA, which, in turn, induces myosin filament formation. Also activates RHOG. Does not activate RAC1, or to a much lower extent than RHOA and RHOG. Part of a functional unit, involvi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00621	RhoGEF	165 → 351	RhoGEF domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest expression in the placenta. Low levels in small intestine, lung, liver, kidney, thymus and heart.

Sequence

MKAFGPPHEGPLQGLVASRIETYGGRHRASAQSTAGRLYPRGYPVLDPSRRRLQQYVPFA
RGSGQARGLSPMRLRDPEPEKRHGGHVGAGLLHSPKLKELTKAHELEVRLHTFSMFGMPR
LPPEDRRHWEIGEGGDSGLTIEKSWRELVPGHKEMSQELCHQQEALWELLTTELIYVRKL
KIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQP
LDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQ
MLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHINGQVRQGEEQ
ESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKE
GREGKLDVYLFLFSDVLLVTKPQRKADKAKVIRPPLMLEKLVCQPLRDPNSFLLIHLTEF
QCVSSALLVHCPSPTDRAQWLEKTQQAQAALQKLKAEEYVQQKRELLTLYRDQDRESPST
RPSTPSLEGSQSSAEGRTPEFSTIIPHLVVTEDTDEDAPLVPDDTSDSGYGTLIPGTPTG
SRSPLSRLRQRALRRDPRLTFSTLELRDIPLRPHPPDPQAPQRRSAPELPEGILKGGSLP
QEDPPTWSEEEDGASERGNVVVETLHRARLRGQLPSSPTHADSAGESPWESSGEEEEEGP
LFLKAGHTSLRPMRAEDMLREIREELASQRIEGAEEPRDSRPRKLTRAQLQRMRGPHIIQ
LDTPLSASEV

Sequence length

790

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL ADENOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLEKHG6-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20634288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25336641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20634288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periventricular Nodular Heterotopia	Periventricular Nodular Heterotopia	BEFREE	30517861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28388658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PLEKHG6 (pleckstrin homology and RhoGEF domain containing G6)