AVPR1A (arginine vasopressin receptor 1A)

Gene

• Entrez ID: 552
• Gene name: Arginine vasopressin receptor 1A
• Gene symbol: AVPR1A
• Synonyms (NCBI Gene): AVPR V1a, AVPR1, V1aR
• Chromosome: 12
• Chromosome location: 12q14.2
• Summary: The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosph

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT620542	hsa-miR-1276	HITS-CLIP	23824327
MIRT620541	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT620540	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT620539	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT620538	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT620537	hsa-miR-8073	HITS-CLIP	23824327
MIRT620536	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT620535	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT620534	hsa-miR-3128	HITS-CLIP	23824327
MIRT620533	hsa-miR-548aj-5p	HITS-CLIP	23824327
MIRT620532	hsa-miR-548f-5p	HITS-CLIP	23824327
MIRT620531	hsa-miR-548g-5p	HITS-CLIP	23824327
MIRT620530	hsa-miR-548x-5p	HITS-CLIP	23824327
MIRT620529	hsa-miR-4252	HITS-CLIP	23824327
MIRT620528	hsa-miR-4470	HITS-CLIP	23824327
MIRT620527	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT620526	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT620525	hsa-miR-7703	HITS-CLIP	23824327
MIRT499852	hsa-miR-8084	PAR-CLIP	22012620
MIRT499851	hsa-miR-200b-3p	PAR-CLIP	22012620
MIRT499850	hsa-miR-200c-3p	PAR-CLIP	22012620
MIRT499849	hsa-miR-429	PAR-CLIP	22012620
MIRT499848	hsa-miR-944	PAR-CLIP	22012620
MIRT499846	hsa-miR-369-3p	PAR-CLIP	22012620
MIRT499847	hsa-miR-5692b	PAR-CLIP	22012620
MIRT499845	hsa-miR-5692c	PAR-CLIP	22012620
MIRT499844	hsa-miR-126-5p	PAR-CLIP	22012620
MIRT499843	hsa-miR-374a-5p	PAR-CLIP	22012620
MIRT499842	hsa-miR-374b-5p	PAR-CLIP	22012620
MIRT499841	hsa-miR-4795-3p	PAR-CLIP	22012620
MIRT499852	hsa-miR-8084	PAR-CLIP	24398324
MIRT499851	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT499850	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT499849	hsa-miR-429	PAR-CLIP	24398324
MIRT499848	hsa-miR-944	PAR-CLIP	24398324
MIRT499846	hsa-miR-369-3p	PAR-CLIP	24398324
MIRT499847	hsa-miR-5692b	PAR-CLIP	24398324
MIRT499845	hsa-miR-5692c	PAR-CLIP	24398324
MIRT499844	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT499843	hsa-miR-374a-5p	PAR-CLIP	24398324
MIRT499842	hsa-miR-374b-5p	PAR-CLIP	24398324
MIRT499841	hsa-miR-4795-3p	PAR-CLIP	24398324
MIRT443624	hsa-miR-548e-5p	PAR-CLIP	22100165
MIRT443623	hsa-miR-3606-3p	PAR-CLIP	22100165
MIRT443622	hsa-miR-513a-3p	PAR-CLIP	22100165
MIRT443621	hsa-miR-513c-3p	PAR-CLIP	22100165
MIRT443620	hsa-miR-1244	PAR-CLIP	22100165
MIRT443619	hsa-miR-8063	PAR-CLIP	22100165
MIRT443618	hsa-miR-4698	PAR-CLIP	22100165
MIRT443617	hsa-miR-5697	PAR-CLIP	22100165
MIRT443616	hsa-miR-4480	PAR-CLIP	22100165
MIRT443614	hsa-miR-607	PAR-CLIP	22100165
MIRT499844	hsa-miR-126-5p	PAR-CLIP	27292025
MIRT499851	hsa-miR-200b-3p	PAR-CLIP	27292025
MIRT499850	hsa-miR-200c-3p	PAR-CLIP	27292025
MIRT499846	hsa-miR-369-3p	PAR-CLIP	27292025
MIRT499843	hsa-miR-374a-5p	PAR-CLIP	27292025
MIRT499842	hsa-miR-374b-5p	PAR-CLIP	27292025
MIRT499849	hsa-miR-429	PAR-CLIP	27292025
MIRT499841	hsa-miR-4795-3p	PAR-CLIP	27292025
MIRT499847	hsa-miR-5692b	PAR-CLIP	27292025
MIRT499845	hsa-miR-5692c	PAR-CLIP	27292025
MIRT499852	hsa-miR-8084	PAR-CLIP	27292025
MIRT499848	hsa-miR-944	PAR-CLIP	27292025
MIRT620542	hsa-miR-1276	HITS-CLIP	23824327
MIRT620541	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT620540	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT620539	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT620538	hsa-miR-221-5p	HITS-CLIP	23824327
MIRT620537	hsa-miR-8073	HITS-CLIP	23824327
MIRT620536	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT620535	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT620534	hsa-miR-3128	HITS-CLIP	23824327
MIRT620533	hsa-miR-548aj-5p	HITS-CLIP	23824327
MIRT620532	hsa-miR-548f-5p	HITS-CLIP	23824327
MIRT620531	hsa-miR-548g-5p	HITS-CLIP	23824327
MIRT620530	hsa-miR-548x-5p	HITS-CLIP	23824327
MIRT620529	hsa-miR-4252	HITS-CLIP	23824327
MIRT620528	hsa-miR-4470	HITS-CLIP	23824327
MIRT620527	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT620526	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT620525	hsa-miR-7703	HITS-CLIP	23824327
MIRT499852	hsa-miR-8084	PAR-CLIP	22012620
MIRT499851	hsa-miR-200b-3p	PAR-CLIP	22012620
MIRT499850	hsa-miR-200c-3p	PAR-CLIP	22012620
MIRT499849	hsa-miR-429	PAR-CLIP	22012620
MIRT499848	hsa-miR-944	PAR-CLIP	22012620
MIRT499846	hsa-miR-369-3p	PAR-CLIP	22012620
MIRT499847	hsa-miR-5692b	PAR-CLIP	22012620
MIRT499845	hsa-miR-5692c	PAR-CLIP	22012620
MIRT499844	hsa-miR-126-5p	PAR-CLIP	22012620
MIRT499843	hsa-miR-374a-5p	PAR-CLIP	22012620
MIRT499842	hsa-miR-374b-5p	PAR-CLIP	22012620
MIRT499841	hsa-miR-4795-3p	PAR-CLIP	22012620
MIRT499852	hsa-miR-8084	PAR-CLIP	24398324
MIRT499851	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT499850	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT499849	hsa-miR-429	PAR-CLIP	24398324
MIRT499848	hsa-miR-944	PAR-CLIP	24398324
MIRT499846	hsa-miR-369-3p	PAR-CLIP	24398324
MIRT499847	hsa-miR-5692b	PAR-CLIP	24398324
MIRT499845	hsa-miR-5692c	PAR-CLIP	24398324
MIRT499844	hsa-miR-126-5p	PAR-CLIP	24398324
MIRT499843	hsa-miR-374a-5p	PAR-CLIP	24398324
MIRT499842	hsa-miR-374b-5p	PAR-CLIP	24398324
MIRT499841	hsa-miR-4795-3p	PAR-CLIP	24398324
MIRT443624	hsa-miR-548e-5p	PAR-CLIP	22100165
MIRT443623	hsa-miR-3606-3p	PAR-CLIP	22100165
MIRT443622	hsa-miR-513a-3p	PAR-CLIP	22100165
MIRT443621	hsa-miR-513c-3p	PAR-CLIP	22100165
MIRT443620	hsa-miR-1244	PAR-CLIP	22100165
MIRT443619	hsa-miR-8063	PAR-CLIP	22100165
MIRT443618	hsa-miR-4698	PAR-CLIP	22100165
MIRT443617	hsa-miR-5697	PAR-CLIP	22100165
MIRT443616	hsa-miR-4480	PAR-CLIP	22100165
MIRT443614	hsa-miR-607	PAR-CLIP	22100165
MIRT812333	hsa-miR-1229	CLIP-seq
MIRT812334	hsa-miR-1238	CLIP-seq
MIRT812335	hsa-miR-141	CLIP-seq
MIRT812336	hsa-miR-194	CLIP-seq
MIRT812337	hsa-miR-200a	CLIP-seq
MIRT812338	hsa-miR-219-2-3p	CLIP-seq
MIRT812339	hsa-miR-2964a-3p	CLIP-seq
MIRT812340	hsa-miR-3183	CLIP-seq
MIRT812341	hsa-miR-4291	CLIP-seq
MIRT812342	hsa-miR-4310	CLIP-seq
MIRT812343	hsa-miR-4723-3p	CLIP-seq
MIRT812344	hsa-miR-4731-3p	CLIP-seq
MIRT812345	hsa-miR-4801	CLIP-seq
MIRT812346	hsa-miR-485-3p	CLIP-seq
MIRT1940246	hsa-miR-4701-5p	CLIP-seq
MIRT1940247	hsa-miR-588	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IBA
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IEA
GO:0002125	Process	Maternal aggressive behavior	IEA
GO:0003084	Process	Positive regulation of systemic arterial blood pressure	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005000	Function	Vasopressin receptor activity	IBA
GO:0005000	Function	Vasopressin receptor activity	IDA	9322919
GO:0005000	Function	Vasopressin receptor activity	IEA
GO:0005000	Function	Vasopressin receptor activity	TAS	10858434
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005080	Function	Protein kinase C binding	TAS	10858434
GO:0005515	Function	Protein binding	IPI	18402937, 29386406
GO:0005768	Component	Endosome	IDA	14757828
GO:0005768	Component	Endosome	TAS	10858434
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	14757828
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8838314, 10858434
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	8106369
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	9322919
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10858434
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	8106369
GO:0007621	Process	Negative regulation of female receptivity	IEA
GO:0007625	Process	Grooming behavior	IEA
GO:0008015	Process	Blood circulation	TAS	8106369
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0010460	Process	Positive regulation of heart rate	IEA
GO:0014049	Process	Positive regulation of glutamate secretion	IEA
GO:0014902	Process	Myotube differentiation	IEA
GO:0016020	Component	Membrane	IEA
GO:0017046	Function	Peptide hormone binding	IEA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0021537	Process	Telencephalon development	IEA
GO:0030139	Component	Endocytic vesicle	IDA	14757828
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0031394	Process	Positive regulation of prostaglandin biosynthetic process	IEA
GO:0031894	Function	V1A vasopressin receptor binding	IEA
GO:0032849	Process	Positive regulation of cellular pH reduction	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0035176	Process	Social behavior	IEA
GO:0042631	Process	Cellular response to water deprivation	IEA
GO:0042711	Process	Maternal behavior	IEA
GO:0042713	Process	Sperm ejaculation	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IBA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051970	Process	Negative regulation of transmission of nerve impulse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653

Other IDs

• MIM: 600821
• HGNC: 895
• e!Ensembl: ENSG00000166148

Protein

• UniProt ID: P37288
• Protein name: Vasopressin V1a receptor (V1aR) (AVPR V1a) (Antidiuretic hormone receptor 1a) (Vascular/hepatic-type arginine vasopressin receptor)
• Protein function: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Has been involved in social behaviors, including affiliation and attachment. {ECO:
• PDB: 1YTV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	68 → 348	7 transmembrane receptor (rhodopsin family)	Family
  PF08983	DUF1856	372 → 418	Domain of unknown function (DUF1856)	Domain

• Sequence:

  MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAV
  TFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGP
  DWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFV
  LSTPQYFVFSMIEVNNVTKARDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFIC
  YNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY
  IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMFFSGHLLQDCV
  QSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST

• Sequence length: 418

Pathways

KEGG:

Calcium signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Vascular smooth muscle contraction

Reactome:

Vasopressin-like receptors
G alpha (q) signalling events
Defective AVP does not bind AVPR1A,B and causes neurohypophyseal diabetes insipidus (NDI)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD, ClinGen CTD, ClinGen	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AVPR1A-related disorder	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anemia Sickle Cell	Sickle cell anemia	Pubtator	31710639	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31710639		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	28769746		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29958961		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	24924430, 29958961		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27027249, 28808521, 29309996	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	16520824, 19195791, 20452058, 20546835, 27027249, 27711048, 29309996, 29503216, 30514927, 31043521		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	CTD_human_DG	20546835		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	12082568, 15098001, 16520824, 18490926, 18655900, 22764113, 24924430, 25707602, 27874273		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	LHGDN	12082568, 16520824		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	16520824		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	18490926, 22764113, 28808521	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Small Cell	Small cell carcinoma	Pubtator	9357056	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	25205804		★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct Disorder	BEFREE	27350097		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	CTD_human_DG	17218722		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	25205804, 31645268		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	24373571	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29958961		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19056558		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19056558		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	31138298		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	12358153, 17653244		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	12358153	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	25205804, 31645268		★☆☆☆☆ Found in Text Mining only
Hypersexuality state	Hypersexuality	BEFREE	16403186		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	31053625	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	17653244		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	21677697, 29182374, 31053625		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	24924430		★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	24849541	Associate	★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	31042456		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29958961		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29182374	Associate	★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	29980755		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19056558		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	35203352	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	20452058, 29503216, 31043521		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	31622604		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39501331	Associate	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	37373400	Stimulate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	17227684, 25529259		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	25529259, 29108272		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Disorders	Sleep Disorders	BEFREE	31132568		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16043261, 9581826		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	15613460	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32337286	Associate	★☆☆☆☆ Found in Text Mining only