Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55193
Gene name	Polybromo 1
Gene symbol	PBRM1
Synonyms (NCBI Gene)	BAF180PB1RCCSMARCH1
Chromosome	3
Chromosome location	3p21.1
Summary	This locus encodes a subunit of ATP-dependent chromatin-remodeling complexes. The encoded protein has been identified as in integral component of complexes necessary for ligand-dependent transcriptional activation by nuclear hormone receptors. Mutations a

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs864321679	CACTATCT>-	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant

300

Show/Hide all (300)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005153	hsa-miR-30a-5p	pSILAC	18668040
MIRT020793	hsa-miR-155-5p	Proteomics	18668040
MIRT020793	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT028017	hsa-miR-93-5p	Sequencing	20371350
MIRT005153	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT030867	hsa-miR-21-5p	Microarray	18591254
MIRT036962	hsa-miR-877-3p	CLASH	23622248
MIRT036515	hsa-miR-1226-3p	CLASH	23622248
MIRT036263	hsa-miR-1229-3p	CLASH	23622248
MIRT547193	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT005153	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT547192	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT547191	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT547190	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT547189	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT547188	hsa-miR-3129-3p	PAR-CLIP	21572407
MIRT547187	hsa-miR-5583-5p	PAR-CLIP	21572407
MIRT547186	hsa-miR-4528	PAR-CLIP	21572407
MIRT547185	hsa-miR-3607-3p	PAR-CLIP	21572407
MIRT547184	hsa-miR-3686	PAR-CLIP	21572407
MIRT727004	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT727003	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT727001	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT727002	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT547193	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT005153	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT547192	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT547191	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT547190	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT547189	hsa-miR-7844-5p	PAR-CLIP	21572407
MIRT547188	hsa-miR-3129-3p	PAR-CLIP	21572407
MIRT547187	hsa-miR-5583-5p	PAR-CLIP	21572407
MIRT547186	hsa-miR-4528	PAR-CLIP	21572407
MIRT547185	hsa-miR-3607-3p	PAR-CLIP	21572407
MIRT547184	hsa-miR-3686	PAR-CLIP	21572407
MIRT1215697	hsa-miR-204	CLIP-seq
MIRT1215698	hsa-miR-211	CLIP-seq
MIRT1215699	hsa-miR-3145-5p	CLIP-seq
MIRT1215700	hsa-miR-340	CLIP-seq
MIRT1215701	hsa-miR-3618	CLIP-seq
MIRT1215702	hsa-miR-3691-3p	CLIP-seq
MIRT1215703	hsa-miR-3938	CLIP-seq
MIRT1215704	hsa-miR-4330	CLIP-seq
MIRT1215705	hsa-miR-4477a	CLIP-seq
MIRT1215706	hsa-miR-4755-5p	CLIP-seq
MIRT1215707	hsa-miR-4764-3p	CLIP-seq
MIRT1215708	hsa-miR-548a-3p	CLIP-seq
MIRT1215709	hsa-miR-548e	CLIP-seq
MIRT1215710	hsa-miR-548f	CLIP-seq
MIRT1215711	hsa-miR-577	CLIP-seq
MIRT1215712	hsa-miR-618	CLIP-seq
MIRT1215713	hsa-miR-623	CLIP-seq
MIRT1215714	hsa-miR-1324	CLIP-seq
MIRT1215715	hsa-miR-198	CLIP-seq
MIRT1215716	hsa-miR-22	CLIP-seq
MIRT1215717	hsa-miR-3158-5p	CLIP-seq
MIRT1215718	hsa-miR-3166	CLIP-seq
MIRT1215719	hsa-miR-323-3p	CLIP-seq
MIRT1215720	hsa-miR-3679-3p	CLIP-seq
MIRT1215721	hsa-miR-3920	CLIP-seq
MIRT1215722	hsa-miR-4446-5p	CLIP-seq
MIRT1215723	hsa-miR-4459	CLIP-seq
MIRT1215724	hsa-miR-4667-3p	CLIP-seq
MIRT1215725	hsa-miR-4771	CLIP-seq
MIRT1215726	hsa-miR-665	CLIP-seq
MIRT1215727	hsa-miR-1197	CLIP-seq
MIRT1215728	hsa-miR-1273g	CLIP-seq
MIRT1215729	hsa-miR-140-5p	CLIP-seq
MIRT1215730	hsa-miR-142-5p	CLIP-seq
MIRT1215731	hsa-miR-1825	CLIP-seq
MIRT1215732	hsa-miR-199a-5p	CLIP-seq
MIRT1215733	hsa-miR-199b-5p	CLIP-seq
MIRT1215734	hsa-miR-23a	CLIP-seq
MIRT1215735	hsa-miR-23b	CLIP-seq
MIRT1215736	hsa-miR-23c	CLIP-seq
MIRT1215737	hsa-miR-30a	CLIP-seq
MIRT1215738	hsa-miR-30b	CLIP-seq
MIRT1215739	hsa-miR-30c	CLIP-seq
MIRT1215740	hsa-miR-30d	CLIP-seq
MIRT1215741	hsa-miR-30e	CLIP-seq
MIRT1215742	hsa-miR-3121-3p	CLIP-seq
MIRT1215743	hsa-miR-3135	CLIP-seq
MIRT1215744	hsa-miR-3161	CLIP-seq
MIRT1215745	hsa-miR-3183	CLIP-seq
MIRT1215746	hsa-miR-34b	CLIP-seq
MIRT1215747	hsa-miR-362-5p	CLIP-seq
MIRT1215748	hsa-miR-410	CLIP-seq
MIRT1215749	hsa-miR-4277	CLIP-seq
MIRT1215750	hsa-miR-4420	CLIP-seq
MIRT1215751	hsa-miR-4426	CLIP-seq
MIRT1215752	hsa-miR-4484	CLIP-seq
MIRT1215753	hsa-miR-4495	CLIP-seq
MIRT1215754	hsa-miR-4509	CLIP-seq
MIRT1215755	hsa-miR-4647	CLIP-seq
MIRT1215756	hsa-miR-4662b	CLIP-seq
MIRT1215757	hsa-miR-4698	CLIP-seq
MIRT1215758	hsa-miR-4699-5p	CLIP-seq
MIRT1215759	hsa-miR-4709-3p	CLIP-seq
MIRT1215760	hsa-miR-4723-3p	CLIP-seq
MIRT1215761	hsa-miR-4762-5p	CLIP-seq
MIRT1215762	hsa-miR-500b	CLIP-seq
MIRT1215763	hsa-miR-501-5p	CLIP-seq
MIRT1215764	hsa-miR-548aa	CLIP-seq
MIRT1215765	hsa-miR-548an	CLIP-seq
MIRT1215766	hsa-miR-548c-3p	CLIP-seq
MIRT1215767	hsa-miR-563	CLIP-seq
MIRT1215711	hsa-miR-577	CLIP-seq
MIRT1215768	hsa-miR-599	CLIP-seq
MIRT1215769	hsa-miR-889	CLIP-seq
MIRT1215766	hsa-miR-548c-3p	CLIP-seq
MIRT2062085	hsa-miR-101	CLIP-seq
MIRT1215728	hsa-miR-1273g	CLIP-seq
MIRT2062086	hsa-miR-1287	CLIP-seq
MIRT1215729	hsa-miR-140-5p	CLIP-seq
MIRT2062087	hsa-miR-142-3p	CLIP-seq
MIRT1215730	hsa-miR-142-5p	CLIP-seq
MIRT2062088	hsa-miR-144	CLIP-seq
MIRT1215731	hsa-miR-1825	CLIP-seq
MIRT1215732	hsa-miR-199a-5p	CLIP-seq
MIRT1215733	hsa-miR-199b-5p	CLIP-seq
MIRT2062089	hsa-miR-203	CLIP-seq
MIRT2062090	hsa-miR-21	CLIP-seq
MIRT2062091	hsa-miR-217	CLIP-seq
MIRT2062092	hsa-miR-2909	CLIP-seq
MIRT2062093	hsa-miR-3064-5p	CLIP-seq
MIRT2062094	hsa-miR-3065-3p	CLIP-seq
MIRT2062095	hsa-miR-3137	CLIP-seq
MIRT1215744	hsa-miR-3161	CLIP-seq
MIRT2062096	hsa-miR-3162-5p	CLIP-seq
MIRT2062097	hsa-miR-3163	CLIP-seq
MIRT2062098	hsa-miR-3171	CLIP-seq
MIRT2062099	hsa-miR-3174	CLIP-seq
MIRT1215719	hsa-miR-323-3p	CLIP-seq
MIRT2062100	hsa-miR-331-3p	CLIP-seq
MIRT2062101	hsa-miR-361-3p	CLIP-seq
MIRT2062102	hsa-miR-3652	CLIP-seq
MIRT2062103	hsa-miR-3662	CLIP-seq
MIRT2062104	hsa-miR-3671	CLIP-seq
MIRT1215720	hsa-miR-3679-3p	CLIP-seq
MIRT2062105	hsa-miR-3921	CLIP-seq
MIRT1215748	hsa-miR-410	CLIP-seq
MIRT2062106	hsa-miR-4263	CLIP-seq
MIRT2062107	hsa-miR-4269	CLIP-seq
MIRT2062108	hsa-miR-4307	CLIP-seq
MIRT2062109	hsa-miR-4418	CLIP-seq
MIRT2062110	hsa-miR-4424	CLIP-seq
MIRT2062111	hsa-miR-4430	CLIP-seq
MIRT1215705	hsa-miR-4477a	CLIP-seq
MIRT2062112	hsa-miR-4505	CLIP-seq
MIRT2062113	hsa-miR-4514	CLIP-seq
MIRT2062114	hsa-miR-4653-5p	CLIP-seq
MIRT2062115	hsa-miR-4682	CLIP-seq
MIRT2062116	hsa-miR-4692	CLIP-seq
MIRT2062117	hsa-miR-4731-3p	CLIP-seq
MIRT2062118	hsa-miR-4742-5p	CLIP-seq
MIRT1215761	hsa-miR-4762-5p	CLIP-seq
MIRT2062119	hsa-miR-4795-3p	CLIP-seq
MIRT2062120	hsa-miR-4801	CLIP-seq
MIRT2062121	hsa-miR-494	CLIP-seq
MIRT2062122	hsa-miR-495	CLIP-seq
MIRT2062123	hsa-miR-509-3-5p	CLIP-seq
MIRT2062124	hsa-miR-509-5p	CLIP-seq
MIRT2062125	hsa-miR-512-5p	CLIP-seq
MIRT1215708	hsa-miR-548a-3p	CLIP-seq
MIRT1215709	hsa-miR-548e	CLIP-seq
MIRT1215710	hsa-miR-548f	CLIP-seq
MIRT2062126	hsa-miR-548t	CLIP-seq
MIRT1215767	hsa-miR-563	CLIP-seq
MIRT2062127	hsa-miR-570	CLIP-seq
MIRT2062128	hsa-miR-576-5p	CLIP-seq
MIRT2062129	hsa-miR-590-5p	CLIP-seq
MIRT2062130	hsa-miR-603	CLIP-seq
MIRT2062131	hsa-miR-607	CLIP-seq
MIRT2062132	hsa-miR-633	CLIP-seq
MIRT2062133	hsa-miR-642b	CLIP-seq
MIRT2062134	hsa-miR-656	CLIP-seq
MIRT2062135	hsa-miR-671-5p	CLIP-seq
MIRT1215769	hsa-miR-889	CLIP-seq
MIRT2062136	hsa-miR-921	CLIP-seq
MIRT2062085	hsa-miR-101	CLIP-seq
MIRT1215727	hsa-miR-1197	CLIP-seq
MIRT1215728	hsa-miR-1273g	CLIP-seq
MIRT2062086	hsa-miR-1287	CLIP-seq
MIRT2290588	hsa-miR-1290	CLIP-seq
MIRT1215714	hsa-miR-1324	CLIP-seq
MIRT1215729	hsa-miR-140-5p	CLIP-seq
MIRT2062087	hsa-miR-142-3p	CLIP-seq
MIRT2062088	hsa-miR-144	CLIP-seq
MIRT1215731	hsa-miR-1825	CLIP-seq
MIRT1215732	hsa-miR-199a-5p	CLIP-seq
MIRT1215733	hsa-miR-199b-5p	CLIP-seq
MIRT2062089	hsa-miR-203	CLIP-seq
MIRT2062090	hsa-miR-21	CLIP-seq
MIRT2290589	hsa-miR-2110	CLIP-seq
MIRT1215716	hsa-miR-22	CLIP-seq
MIRT2290590	hsa-miR-2278	CLIP-seq
MIRT1215734	hsa-miR-23a	CLIP-seq
MIRT1215735	hsa-miR-23b	CLIP-seq
MIRT1215736	hsa-miR-23c	CLIP-seq
MIRT2062092	hsa-miR-2909	CLIP-seq
MIRT2290591	hsa-miR-29a	CLIP-seq
MIRT2290592	hsa-miR-29b	CLIP-seq
MIRT2290593	hsa-miR-29c	CLIP-seq
MIRT2290594	hsa-miR-300	CLIP-seq
MIRT2062093	hsa-miR-3064-5p	CLIP-seq
MIRT2062094	hsa-miR-3065-3p	CLIP-seq
MIRT1215737	hsa-miR-30a	CLIP-seq
MIRT1215738	hsa-miR-30b	CLIP-seq
MIRT1215739	hsa-miR-30c	CLIP-seq
MIRT1215740	hsa-miR-30d	CLIP-seq
MIRT1215741	hsa-miR-30e	CLIP-seq
MIRT2062095	hsa-miR-3137	CLIP-seq
MIRT1215699	hsa-miR-3145-5p	CLIP-seq
MIRT2290595	hsa-miR-3150a-3p	CLIP-seq
MIRT1215717	hsa-miR-3158-5p	CLIP-seq
MIRT2062096	hsa-miR-3162-5p	CLIP-seq
MIRT1215718	hsa-miR-3166	CLIP-seq
MIRT2062099	hsa-miR-3174	CLIP-seq
MIRT1215745	hsa-miR-3183	CLIP-seq
MIRT2062100	hsa-miR-331-3p	CLIP-seq
MIRT2290596	hsa-miR-337-3p	CLIP-seq
MIRT1215746	hsa-miR-34b	CLIP-seq
MIRT1215701	hsa-miR-3618	CLIP-seq
MIRT2062102	hsa-miR-3652	CLIP-seq
MIRT2062103	hsa-miR-3662	CLIP-seq
MIRT2062104	hsa-miR-3671	CLIP-seq
MIRT1215702	hsa-miR-3691-3p	CLIP-seq
MIRT2290597	hsa-miR-381	CLIP-seq
MIRT1215721	hsa-miR-3920	CLIP-seq
MIRT2062105	hsa-miR-3921	CLIP-seq
MIRT2290598	hsa-miR-4260	CLIP-seq
MIRT1215749	hsa-miR-4277	CLIP-seq
MIRT1215704	hsa-miR-4330	CLIP-seq
MIRT2062110	hsa-miR-4424	CLIP-seq
MIRT1215751	hsa-miR-4426	CLIP-seq
MIRT2062111	hsa-miR-4430	CLIP-seq
MIRT2290599	hsa-miR-4450	CLIP-seq
MIRT1215705	hsa-miR-4477a	CLIP-seq
MIRT1215752	hsa-miR-4484	CLIP-seq
MIRT1215753	hsa-miR-4495	CLIP-seq
MIRT2062112	hsa-miR-4505	CLIP-seq
MIRT1215754	hsa-miR-4509	CLIP-seq
MIRT2290600	hsa-miR-450b-5p	CLIP-seq
MIRT1215755	hsa-miR-4647	CLIP-seq
MIRT2290601	hsa-miR-4652-3p	CLIP-seq
MIRT2062114	hsa-miR-4653-5p	CLIP-seq
MIRT2290602	hsa-miR-4659a-3p	CLIP-seq
MIRT2290603	hsa-miR-4659b-3p	CLIP-seq
MIRT1215756	hsa-miR-4662b	CLIP-seq
MIRT2290604	hsa-miR-4666-3p	CLIP-seq
MIRT2062115	hsa-miR-4682	CLIP-seq
MIRT1215760	hsa-miR-4723-3p	CLIP-seq
MIRT2062117	hsa-miR-4731-3p	CLIP-seq
MIRT2290605	hsa-miR-4749-3p	CLIP-seq
MIRT1215761	hsa-miR-4762-5p	CLIP-seq
MIRT1215725	hsa-miR-4771	CLIP-seq
MIRT2290606	hsa-miR-4793-3p	CLIP-seq
MIRT2062120	hsa-miR-4801	CLIP-seq
MIRT2062121	hsa-miR-494	CLIP-seq
MIRT2062125	hsa-miR-512-5p	CLIP-seq
MIRT2290607	hsa-miR-513b	CLIP-seq
MIRT2290608	hsa-miR-515-5p	CLIP-seq
MIRT1215708	hsa-miR-548a-3p	CLIP-seq
MIRT1215765	hsa-miR-548an	CLIP-seq
MIRT1215766	hsa-miR-548c-3p	CLIP-seq
MIRT1215709	hsa-miR-548e	CLIP-seq
MIRT1215710	hsa-miR-548f	CLIP-seq
MIRT1215767	hsa-miR-563	CLIP-seq
MIRT1215711	hsa-miR-577	CLIP-seq
MIRT2062129	hsa-miR-590-5p	CLIP-seq
MIRT2062130	hsa-miR-603	CLIP-seq
MIRT2062131	hsa-miR-607	CLIP-seq
MIRT2062132	hsa-miR-633	CLIP-seq
MIRT2062133	hsa-miR-642b	CLIP-seq
MIRT2062135	hsa-miR-671-5p	CLIP-seq
MIRT2290609	hsa-miR-873	CLIP-seq
MIRT2062136	hsa-miR-921	CLIP-seq
MIRT2290610	hsa-miR-942	CLIP-seq
MIRT2062091	hsa-miR-217	CLIP-seq
MIRT2062092	hsa-miR-2909	CLIP-seq
MIRT2062093	hsa-miR-3064-5p	CLIP-seq
MIRT2062094	hsa-miR-3065-3p	CLIP-seq
MIRT2062096	hsa-miR-3162-5p	CLIP-seq
MIRT2062100	hsa-miR-331-3p	CLIP-seq
MIRT2062102	hsa-miR-3652	CLIP-seq
MIRT2062109	hsa-miR-4418	CLIP-seq
MIRT1215750	hsa-miR-4420	CLIP-seq
MIRT2062111	hsa-miR-4430	CLIP-seq
MIRT2062112	hsa-miR-4505	CLIP-seq
MIRT2290606	hsa-miR-4793-3p	CLIP-seq
MIRT2062123	hsa-miR-509-3-5p	CLIP-seq
MIRT2062124	hsa-miR-509-5p	CLIP-seq
MIRT2062125	hsa-miR-512-5p	CLIP-seq
MIRT2062126	hsa-miR-548t	CLIP-seq
MIRT2062130	hsa-miR-603	CLIP-seq
MIRT2062133	hsa-miR-642b	CLIP-seq
MIRT2062135	hsa-miR-671-5p	CLIP-seq
MIRT1215730	hsa-miR-142-5p	CLIP-seq
MIRT2062130	hsa-miR-603	CLIP-seq
MIRT2062133	hsa-miR-642b	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000228	Component	Nuclear chromosome	NAS	11078522
GO:0000278	Process	Mitotic cell cycle	TAS	11078522
GO:0000776	Component	Kinetochore	NAS	11078522
GO:0000785	Component	Chromatin	NAS	12192000
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IEA
GO:0003682	Function	Chromatin binding	NAS	11078522
GO:0005515	Function	Protein binding	IPI	11780067, 12368262, 15985610, 20130577, 22140357, 27142060, 35271311
GO:0005634	Component	Nucleus	IDA	25593309
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006338	Process	Chromatin remodeling	NAS	10078207
GO:0006338	Process	Chromatin remodeling	TAS	11078522
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	18809673
GO:0006368	Process	Transcription elongation by RNA polymerase II	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	21248752
GO:0016363	Component	Nuclear matrix	NAS	9128241
GO:0016514	Component	SWI/SNF complex	IBA
GO:0016514	Component	SWI/SNF complex	IDA	8895581
GO:0016586	Component	RSC-type complex	IBA
GO:0016586	Component	RSC-type complex	IEA
GO:0016586	Component	RSC-type complex	NAS	8804307
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	NAS	25066234
GO:0045582	Process	Positive regulation of T cell differentiation	NAS	12110891
GO:0045597	Process	Positive regulation of cell differentiation	NAS	11790558
GO:0045663	Process	Positive regulation of myoblast differentiation	NAS	15985610
GO:0070316	Process	Regulation of G0 to G1 transition	NAS	11790558
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	NAS	10778858
GO:2000781	Process	Positive regulation of double-strand break repair	NAS	25066234
GO:2000819	Process	Regulation of nucleotide-excision repair	NAS	12215535

MIM	HGNC	e!Ensembl
606083	30064	ENSG00000163939

Q86U86

Protein name

Protein polybromo-1 (hPB1) (BRG1-associated factor 180) (BAF180) (Polybromo-1D)

Protein function

Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Required for the stability of the SWI/SNF chromatin remodeling complex SWI/SNF-B (PBAF). Acts as a negative re

PDB

2KTB , 3G0J , 3HMF , 3IU5 , 3IU6 , 3K2J , 3LJW , 3MB4 , 3TLP , 4Q0N , 4Q0O , 4Y03 , 5E7D , 5FH6 , 5FH7 , 5FH8 , 5HRV , 5HRW , 5HRX , 5II1 , 5II2 , 5IID , 6OXB , 6ZN6 , 6ZNV , 6ZS3 , 6ZS4 , 7VDV , 7Y8R , 8FTA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00439	Bromodomain	54 → 139	Bromodomain	Domain
PF00439	Bromodomain	186 → 275	Bromodomain	Domain
PF00439	Bromodomain	393 → 475	Bromodomain	Domain
PF00439	Bromodomain	537 → 613	Bromodomain	Domain
PF00439	Bromodomain	667 → 751	Bromodomain	Domain
PF00439	Bromodomain	783 → 867	Bromodomain	Domain
PF01426	BAH	956 → 1074	BAH domain	Domain
PF01426	BAH	1156 → 1272	BAH domain	Domain
PF00505	HMG_box	1379 → 1446	HMG (high mobility group) box	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:12487023}.

Sequence

MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDY
KDEQGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLF
NNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPA
YLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNG
SYKSIHAMAKDIDLLAKNAKTYNEPGSQVFKDANSIKKIFYMKKAEIEHHEMAKSSLRMR
TPSNLAAARLTGPSHSKGSLGEERNPTSKYYRNKRAVQGGRLSAITMALQYGSESEEDAA
LAAARYEEGESEAESITSFMDVSNPFYQLYDTVRSCRNNQGQLIAEPFYHLPSKKKYPDY
YQQIKMPISLQQIRTKLKNQEYETLDHLECDLNLMFENAKRYNVPNSAIYKRVLKLQQVM
QAKKKELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGR
RLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNIRNDKYAGEEGMIEDMKLMFRNARHY
NEEGSQVYNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQ
KLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQD
IDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQE
LIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLF
QEHMFEVLERARRMNRTDSEIYEDAVELQQFFIKIRDELCKNGEILLSPALSYTTKHLHN
DVEKERKEKLPKEIEEDKLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHV
GDYVYVEPAEANLQPHIVCIERLWEDSAGEKWLYGCWFYRPNETFHLATRKFLEKEVFKS
DYYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRYSAKTKSFKKIKLWTMPI
SSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSN
GEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAAYFYGPIFIHPE
ETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESR
YNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELE
GGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRK
INMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYEERAAKVAEQQE
RERAAQQQQPSASPRAGTPVGALMGVVPPPTPMGMLNQQLTPVAGMMGGYPPGLPPLQGP
VDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPYGQQ
VGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAE
SNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNI
RQAYNLENV

Sequence length

1689

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling Hepatocellular carcinoma		RMTs methylate histone arginines RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Clear cell carcinoma of kidney	Pathogenic	rs864321679	RCV000203297	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (30)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar CTD	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CLEAR CELL PAPILLARY RENAL CELL CARCINOMA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PBRM1-related BAFopathy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (111)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	26717940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	29596882	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	31122820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	29360550, 34145795, 37341068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	21037240, 22560537, 23967141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21037240, 22560537, 23967141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASDB_DG	22182935, 23070075		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25978027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15735765, 18339845, 26464681, 28921948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18339845, 26464681, 36404592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18339845, 27100670, 28394406, 36261012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28394406, 29229903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28731042, 34118935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25978027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15735765, 30377796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28810144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23036577, 23333114, 23416164, 23620406, 23792563, 23867514, 24029645, 24158655, 24821879, 24992170, 25124064, 25465300, 25753955, 26300218, 26452128 View all (57 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Catatonia	Catatonia	BEFREE	29523295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	24185509		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24185509, 24867389, 25536104, 29551704, 31122820, 32293336, 33579226, 33765338, 35726602, 38281914	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28394406		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Chordoma	Chordoma	Pubtator	33536423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	22138691, 23797736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell papillary renal cell carcinoma	Papillary Renal Carcinoma	ORPHANET_DG	25911086		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell papillary renal cell carcinoma	Papillary Renal Carcinoma	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	24029645, 29689242, 30814637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	22138691, 23797736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28940253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28940253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25536104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	22194017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22138691, 23797736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22249190, 22683710, 22805307, 22949125, 23036577, 23333114, 23416164, 23644518, 23792563, 23832661, 23867514, 24029645, 24053427, 24063284, 24158655 View all (39 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26812616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	24185509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	31122820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	31122820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37094128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	38237287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27100670, 29301960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28940253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	24185509, 26717940, 27864835, 28394406, 30377796, 31122820, 31186529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	CTD_human_DG	24185509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	23036577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	23867514, 32396860, 35368029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30520820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	38237287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15735765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26464681	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	22560537		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	22560537		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	22560537		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	22560537		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	22560537		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	22560537		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	22560537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASDB_DG	22472876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	24916674, 27834213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15735765, 18339845, 26464681, 28921948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	31122820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23416164, 29229903, 30585695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15735765, 30377796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23229642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31212728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25978027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22435813, 24613357, 25169151, 27100670, 27834213, 28459210, 28846693, 28921948, 29426696, 30030490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28940253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	33087175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	34531524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	27834213, 32504035, 35849291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	34294844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASDB_DG	20081856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	20081856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	30660076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15735765, 18339845, 19603527, 22385958, 22683710, 22949125, 23036577, 23229642, 23333114, 23620406, 23832661, 23867514, 24053427, 24063284, 24166983 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	Pubtator	36917021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	23967141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	23967141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oncocytoma, renal	Oncocytoma of kidney	BEFREE	25465300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23229642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23229642, 34375311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	22138691, 23797736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	30862609, 37453150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31212728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31212728, 36227159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	23967141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	23967141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychotic disorders	Pubtator	23967141	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	21248752, 23416164, 30585695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21248752, 22249190, 22683710, 22949125, 23832661, 23867514, 24063284, 25911086, 26300218, 26452128, 27407122, 28618948, 28846693, 29708949, 29965859 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22138691, 23797736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	22192630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	22192630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	22683710, 26111976, 31912158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	35301413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	22138691, 23797736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21037240, 23967141, 29523295, 31723243		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21037240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	28991256, 30285260		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18339795, 36362284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33481850, 34145795, 35928964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	CTD_human_DG	24974848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	CTD_human_DG	24974848		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Neoplasms	Thyroid cancer	Pubtator	38275291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36445328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	22949125		★★★★★ ★☆☆☆☆ Found in Text Mining only

PBRM1 (polybromo 1)