Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55190
Gene name	Nudix hydrolase 11
Gene symbol	NUDT11
Synonyms (NCBI Gene)	APS1ASP1DIPP3bDIPP3betahDIPP3beta
Chromosome	X
Chromosome location	Xp11.22
Summary	NUDT11 belongs to a subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (Hidaka et al., 2002 [PubMed 12105228]).[supplied by OMIM, Mar 2008]

Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048002	hsa-miR-30c-5p	CLASH	23622248
MIRT1197452	hsa-miR-122	CLIP-seq
MIRT1197453	hsa-miR-1283	CLIP-seq
MIRT1197454	hsa-miR-2681	CLIP-seq
MIRT1197455	hsa-miR-3065-5p	CLIP-seq
MIRT1197456	hsa-miR-3169	CLIP-seq
MIRT1197457	hsa-miR-323-3p	CLIP-seq
MIRT1197458	hsa-miR-3613-3p	CLIP-seq
MIRT1197459	hsa-miR-3915	CLIP-seq
MIRT1197460	hsa-miR-3928	CLIP-seq
MIRT1197461	hsa-miR-4420	CLIP-seq
MIRT1197462	hsa-miR-4533	CLIP-seq
MIRT1197463	hsa-miR-4740-5p	CLIP-seq
MIRT1197464	hsa-miR-4747-5p	CLIP-seq
MIRT1197465	hsa-miR-4774-5p	CLIP-seq
MIRT1197466	hsa-miR-597	CLIP-seq
MIRT2057179	hsa-miR-3065-3p	CLIP-seq
MIRT2057180	hsa-miR-4275	CLIP-seq
MIRT2057181	hsa-miR-4291	CLIP-seq
MIRT2285551	hsa-miR-4436b-5p	CLIP-seq
MIRT2686673	hsa-miR-29a	CLIP-seq
MIRT2686674	hsa-miR-29b	CLIP-seq
MIRT2686675	hsa-miR-29c	CLIP-seq
MIRT2686676	hsa-miR-3135	CLIP-seq
MIRT2686677	hsa-miR-4643	CLIP-seq
MIRT2686678	hsa-miR-4661-5p	CLIP-seq
MIRT2686679	hsa-miR-4717-3p	CLIP-seq
MIRT2686680	hsa-miR-4731-3p	CLIP-seq
MIRT2686681	hsa-miR-4801	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000298	Function	Endopolyphosphatase activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0008486	Function	Diphosphoinositol-polyphosphate diphosphatase activity	IBA
GO:0008486	Function	Diphosphoinositol-polyphosphate diphosphatase activity	IEA
GO:0008486	Function	Diphosphoinositol-polyphosphate diphosphatase activity	ISS
GO:0016462	Function	Pyrophosphatase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0034431	Function	Bis(5'-adenosyl)-hexaphosphatase activity	IBA
GO:0034431	Function	Bis(5'-adenosyl)-hexaphosphatase activity	IEA
GO:0034432	Function	Bis(5'-adenosyl)-pentaphosphatase activity	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0071543	Process	Diphosphoinositol polyphosphate metabolic process	IBA
GO:1901907	Process	Diadenosine pentaphosphate catabolic process	IBA
GO:1901909	Process	Diadenosine hexaphosphate catabolic process	IBA
GO:1901911	Process	Adenosine 5'-(hexahydrogen pentaphosphate) catabolic process	IBA

MIM	HGNC	e!Ensembl
300528	18011	ENSG00000196368

Q96G61

Protein name

Diphosphoinositol polyphosphate phosphohydrolase 3-beta (DIPP-3-beta) (DIPP3-beta) (hDIPP3beta) (EC 3.6.1.52) (Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-beta) (Diadenosine hexaphosphate hydrolase (AMP-forming)) (EC 3.6.1.60) (Nucleoside diphosph

Protein function

Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A an

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00293	NUDIX	16 → 143	NUDIX domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in testis and, at lower level in brain. According to PubMed:12121577, it is also expressed in pancreas and weakly expressed in thymus, prostate, ovary, lung, small intestine and heart. {ECO:0000269|PubMed:12105228, ECO

Sequence

MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGG
AAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVYVLTVTELLEDWEDSVSIGRKREWF
KVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP

Sequence length

164

Interactions

View interactions

	Reactome
			Synthesis of pyrophosphates in the cytosol

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Addison Disease	Addison`s Disease	BEFREE	18200029, 24014553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	28540407		★★★★★ ★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	10656108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	9098524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12503856, 16820279, 17466510, 22224765, 24988226, 26312540, 26912174, 9650097, 9888391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune polyendocrinopathy syndrome, type 1	Autoimmune Polyendocrinopathy	BEFREE	12503856, 16552513, 16784312, 26312540, 26912174, 28540407, 29985347, 9888391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Syndrome Type II, Polyglandular	Polyglandular autoimmune syndrome	BEFREE	16784312, 21677034, 24014553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28887200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	26154078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29508520, 29670255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29550831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	BEFREE	18414681, 28540407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	28137823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28887200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29508520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29670255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	21447630, 21677034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	10690877, 19350199, 20118890, 22933620, 26912174, 9837820, 9856486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyglandular Type I Autoimmune Syndrome	Polyglandular autoimmune syndrome	BEFREE	10920386, 12503856, 16552513, 16784312, 17466510, 18414681, 20876623, 21447630, 24988226, 26312540, 26912174, 28540407, 29985347, 9398839, 9650097, 9888391 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	21677034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21071540, 22730461, 24497837, 25371445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29508520, 29670255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	16784312		★★★★★ ★☆☆☆☆ Found in Text Mining only

NUDT11 (nudix hydrolase 11)