Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55154
Gene name	Misato mitochondrial distribution and morphology regulator 1
Gene symbol	MSTO1
Synonyms (NCBI Gene)	LST005MMYATMST
Chromosome	1
Chromosome location	1q22

238

Show/Hide all (238)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047477	hsa-miR-10b-5p	CLASH	23622248
MIRT042347	hsa-miR-484	CLASH	23622248
MIRT039736	hsa-miR-615-3p	CLASH	23622248
MIRT1161954	hsa-miR-106a	CLIP-seq
MIRT1161955	hsa-miR-106b	CLIP-seq
MIRT1161956	hsa-miR-1225-3p	CLIP-seq
MIRT1161957	hsa-miR-1233	CLIP-seq
MIRT1161958	hsa-miR-1255a	CLIP-seq
MIRT1161959	hsa-miR-1255b	CLIP-seq
MIRT1161960	hsa-miR-128	CLIP-seq
MIRT1161961	hsa-miR-1287	CLIP-seq
MIRT1161962	hsa-miR-1471	CLIP-seq
MIRT1161963	hsa-miR-17	CLIP-seq
MIRT1161964	hsa-miR-1910	CLIP-seq
MIRT1161965	hsa-miR-20a	CLIP-seq
MIRT1161966	hsa-miR-20b	CLIP-seq
MIRT1161967	hsa-miR-2114	CLIP-seq
MIRT1161968	hsa-miR-27a	CLIP-seq
MIRT1161969	hsa-miR-27b	CLIP-seq
MIRT1161970	hsa-miR-28-5p	CLIP-seq
MIRT1161971	hsa-miR-3139	CLIP-seq
MIRT1161972	hsa-miR-326	CLIP-seq
MIRT1161973	hsa-miR-330-5p	CLIP-seq
MIRT1161974	hsa-miR-34b	CLIP-seq
MIRT1161975	hsa-miR-3613-5p	CLIP-seq
MIRT1161976	hsa-miR-3664-5p	CLIP-seq
MIRT1161977	hsa-miR-3670	CLIP-seq
MIRT1161978	hsa-miR-3672	CLIP-seq
MIRT1161979	hsa-miR-3683	CLIP-seq
MIRT1161980	hsa-miR-4263	CLIP-seq
MIRT1161981	hsa-miR-4268	CLIP-seq
MIRT1161982	hsa-miR-448	CLIP-seq
MIRT1161983	hsa-miR-4487	CLIP-seq
MIRT1161984	hsa-miR-4495	CLIP-seq
MIRT1161985	hsa-miR-4522	CLIP-seq
MIRT1161986	hsa-miR-4655-5p	CLIP-seq
MIRT1161987	hsa-miR-4703-3p	CLIP-seq
MIRT1161988	hsa-miR-4714-5p	CLIP-seq
MIRT1161989	hsa-miR-4781-3p	CLIP-seq
MIRT1161990	hsa-miR-4799-5p	CLIP-seq
MIRT1161991	hsa-miR-519a	CLIP-seq
MIRT1161992	hsa-miR-519b-3p	CLIP-seq
MIRT1161993	hsa-miR-519c-3p	CLIP-seq
MIRT1161994	hsa-miR-519d	CLIP-seq
MIRT1161995	hsa-miR-548t	CLIP-seq
MIRT1161996	hsa-miR-554	CLIP-seq
MIRT1161997	hsa-miR-576-5p	CLIP-seq
MIRT1161998	hsa-miR-601	CLIP-seq
MIRT1161999	hsa-miR-708	CLIP-seq
MIRT1162000	hsa-miR-93	CLIP-seq
MIRT2046431	hsa-miR-1292	CLIP-seq
MIRT2046432	hsa-miR-129-5p	CLIP-seq
MIRT2046433	hsa-miR-133a	CLIP-seq
MIRT2046434	hsa-miR-133b	CLIP-seq
MIRT2046435	hsa-miR-150	CLIP-seq
MIRT2046436	hsa-miR-183	CLIP-seq
MIRT2046437	hsa-miR-188-3p	CLIP-seq
MIRT2046438	hsa-miR-4471	CLIP-seq
MIRT2046439	hsa-miR-4502	CLIP-seq
MIRT2046440	hsa-miR-4527	CLIP-seq
MIRT2046441	hsa-miR-4646-5p	CLIP-seq
MIRT2046442	hsa-miR-4713-5p	CLIP-seq
MIRT2046443	hsa-miR-532-3p	CLIP-seq
MIRT2275529	hsa-miR-4267	CLIP-seq
MIRT2275530	hsa-miR-518a-5p	CLIP-seq
MIRT2275531	hsa-miR-527	CLIP-seq
MIRT1161954	hsa-miR-106a	CLIP-seq
MIRT1161955	hsa-miR-106b	CLIP-seq
MIRT1161960	hsa-miR-128	CLIP-seq
MIRT1161962	hsa-miR-1471	CLIP-seq
MIRT1161963	hsa-miR-17	CLIP-seq
MIRT1161965	hsa-miR-20a	CLIP-seq
MIRT1161966	hsa-miR-20b	CLIP-seq
MIRT1161967	hsa-miR-2114	CLIP-seq
MIRT1161968	hsa-miR-27a	CLIP-seq
MIRT1161969	hsa-miR-27b	CLIP-seq
MIRT2454527	hsa-miR-3192	CLIP-seq
MIRT1161972	hsa-miR-326	CLIP-seq
MIRT1161973	hsa-miR-330-5p	CLIP-seq
MIRT1161974	hsa-miR-34b	CLIP-seq
MIRT1161978	hsa-miR-3672	CLIP-seq
MIRT1161980	hsa-miR-4263	CLIP-seq
MIRT2454528	hsa-miR-4273	CLIP-seq
MIRT2454529	hsa-miR-4314	CLIP-seq
MIRT1161982	hsa-miR-448	CLIP-seq
MIRT1161984	hsa-miR-4495	CLIP-seq
MIRT1161985	hsa-miR-4522	CLIP-seq
MIRT2046441	hsa-miR-4646-5p	CLIP-seq
MIRT1161986	hsa-miR-4655-5p	CLIP-seq
MIRT2454530	hsa-miR-4672	CLIP-seq
MIRT2454531	hsa-miR-4677-5p	CLIP-seq
MIRT2454532	hsa-miR-4700-3p	CLIP-seq
MIRT1161989	hsa-miR-4781-3p	CLIP-seq
MIRT1161990	hsa-miR-4799-5p	CLIP-seq
MIRT1161991	hsa-miR-519a	CLIP-seq
MIRT1161992	hsa-miR-519b-3p	CLIP-seq
MIRT1161993	hsa-miR-519c-3p	CLIP-seq
MIRT1161994	hsa-miR-519d	CLIP-seq
MIRT1161995	hsa-miR-548t	CLIP-seq
MIRT1161996	hsa-miR-554	CLIP-seq
MIRT1161997	hsa-miR-576-5p	CLIP-seq
MIRT1161998	hsa-miR-601	CLIP-seq
MIRT1162000	hsa-miR-93	CLIP-seq
MIRT2454527	hsa-miR-3192	CLIP-seq
MIRT1161972	hsa-miR-326	CLIP-seq
MIRT1161973	hsa-miR-330-5p	CLIP-seq
MIRT1161978	hsa-miR-3672	CLIP-seq
MIRT2454529	hsa-miR-4314	CLIP-seq
MIRT1161985	hsa-miR-4522	CLIP-seq
MIRT2046441	hsa-miR-4646-5p	CLIP-seq
MIRT1161986	hsa-miR-4655-5p	CLIP-seq
MIRT2454530	hsa-miR-4672	CLIP-seq
MIRT2454532	hsa-miR-4700-3p	CLIP-seq
MIRT1161954	hsa-miR-106a	CLIP-seq
MIRT1161955	hsa-miR-106b	CLIP-seq
MIRT1161956	hsa-miR-1225-3p	CLIP-seq
MIRT1161957	hsa-miR-1233	CLIP-seq
MIRT1161960	hsa-miR-128	CLIP-seq
MIRT1161962	hsa-miR-1471	CLIP-seq
MIRT1161963	hsa-miR-17	CLIP-seq
MIRT2574572	hsa-miR-185	CLIP-seq
MIRT1161964	hsa-miR-1910	CLIP-seq
MIRT2574573	hsa-miR-1915	CLIP-seq
MIRT1161965	hsa-miR-20a	CLIP-seq
MIRT1161966	hsa-miR-20b	CLIP-seq
MIRT1161967	hsa-miR-2114	CLIP-seq
MIRT2574574	hsa-miR-2278	CLIP-seq
MIRT2574575	hsa-miR-2392	CLIP-seq
MIRT1161968	hsa-miR-27a	CLIP-seq
MIRT1161969	hsa-miR-27b	CLIP-seq
MIRT2574576	hsa-miR-3135b	CLIP-seq
MIRT2454527	hsa-miR-3192	CLIP-seq
MIRT2574577	hsa-miR-3194-3p	CLIP-seq
MIRT1161972	hsa-miR-326	CLIP-seq
MIRT1161973	hsa-miR-330-5p	CLIP-seq
MIRT1161974	hsa-miR-34b	CLIP-seq
MIRT2574578	hsa-miR-3605-5p	CLIP-seq
MIRT1161975	hsa-miR-3613-5p	CLIP-seq
MIRT2574579	hsa-miR-3652	CLIP-seq
MIRT1161976	hsa-miR-3664-5p	CLIP-seq
MIRT1161978	hsa-miR-3672	CLIP-seq
MIRT1161979	hsa-miR-3683	CLIP-seq
MIRT1161980	hsa-miR-4263	CLIP-seq
MIRT2454528	hsa-miR-4273	CLIP-seq
MIRT2574580	hsa-miR-4283	CLIP-seq
MIRT2574581	hsa-miR-4306	CLIP-seq
MIRT2454529	hsa-miR-4314	CLIP-seq
MIRT2574582	hsa-miR-4430	CLIP-seq
MIRT2574583	hsa-miR-4436a	CLIP-seq
MIRT2574584	hsa-miR-4459	CLIP-seq
MIRT1161982	hsa-miR-448	CLIP-seq
MIRT1161984	hsa-miR-4495	CLIP-seq
MIRT1161985	hsa-miR-4522	CLIP-seq
MIRT2574585	hsa-miR-4534	CLIP-seq
MIRT2574586	hsa-miR-4644	CLIP-seq
MIRT2046441	hsa-miR-4646-5p	CLIP-seq
MIRT1161986	hsa-miR-4655-5p	CLIP-seq
MIRT2454530	hsa-miR-4672	CLIP-seq
MIRT2454531	hsa-miR-4677-5p	CLIP-seq
MIRT2574587	hsa-miR-4695-5p	CLIP-seq
MIRT2454532	hsa-miR-4700-3p	CLIP-seq
MIRT1161987	hsa-miR-4703-3p	CLIP-seq
MIRT1161988	hsa-miR-4714-5p	CLIP-seq
MIRT2574588	hsa-miR-4722-5p	CLIP-seq
MIRT2574589	hsa-miR-4727-5p	CLIP-seq
MIRT2574590	hsa-miR-4769-3p	CLIP-seq
MIRT1161989	hsa-miR-4781-3p	CLIP-seq
MIRT1161990	hsa-miR-4799-5p	CLIP-seq
MIRT2574591	hsa-miR-516b	CLIP-seq
MIRT1161991	hsa-miR-519a	CLIP-seq
MIRT1161992	hsa-miR-519b-3p	CLIP-seq
MIRT1161993	hsa-miR-519c-3p	CLIP-seq
MIRT1161994	hsa-miR-519d	CLIP-seq
MIRT1161995	hsa-miR-548t	CLIP-seq
MIRT1161996	hsa-miR-554	CLIP-seq
MIRT1161997	hsa-miR-576-5p	CLIP-seq
MIRT1161998	hsa-miR-601	CLIP-seq
MIRT2574592	hsa-miR-760	CLIP-seq
MIRT2574593	hsa-miR-765	CLIP-seq
MIRT1162000	hsa-miR-93	CLIP-seq
MIRT1161954	hsa-miR-106a	CLIP-seq
MIRT1161955	hsa-miR-106b	CLIP-seq
MIRT1161956	hsa-miR-1225-3p	CLIP-seq
MIRT1161957	hsa-miR-1233	CLIP-seq
MIRT1161960	hsa-miR-128	CLIP-seq
MIRT1161963	hsa-miR-17	CLIP-seq
MIRT2574572	hsa-miR-185	CLIP-seq
MIRT1161964	hsa-miR-1910	CLIP-seq
MIRT1161965	hsa-miR-20a	CLIP-seq
MIRT1161966	hsa-miR-20b	CLIP-seq
MIRT2574574	hsa-miR-2278	CLIP-seq
MIRT2574575	hsa-miR-2392	CLIP-seq
MIRT1161968	hsa-miR-27a	CLIP-seq
MIRT1161969	hsa-miR-27b	CLIP-seq
MIRT2574576	hsa-miR-3135b	CLIP-seq
MIRT2454527	hsa-miR-3192	CLIP-seq
MIRT1161972	hsa-miR-326	CLIP-seq
MIRT1161973	hsa-miR-330-5p	CLIP-seq
MIRT1161974	hsa-miR-34b	CLIP-seq
MIRT2574578	hsa-miR-3605-5p	CLIP-seq
MIRT1161975	hsa-miR-3613-5p	CLIP-seq
MIRT2574579	hsa-miR-3652	CLIP-seq
MIRT1161976	hsa-miR-3664-5p	CLIP-seq
MIRT1161978	hsa-miR-3672	CLIP-seq
MIRT1161980	hsa-miR-4263	CLIP-seq
MIRT2454528	hsa-miR-4273	CLIP-seq
MIRT2574581	hsa-miR-4306	CLIP-seq
MIRT2454529	hsa-miR-4314	CLIP-seq
MIRT2574582	hsa-miR-4430	CLIP-seq
MIRT2574583	hsa-miR-4436a	CLIP-seq
MIRT2574584	hsa-miR-4459	CLIP-seq
MIRT1161982	hsa-miR-448	CLIP-seq
MIRT1161984	hsa-miR-4495	CLIP-seq
MIRT1161985	hsa-miR-4522	CLIP-seq
MIRT2574585	hsa-miR-4534	CLIP-seq
MIRT2574586	hsa-miR-4644	CLIP-seq
MIRT2046441	hsa-miR-4646-5p	CLIP-seq
MIRT1161986	hsa-miR-4655-5p	CLIP-seq
MIRT2454530	hsa-miR-4672	CLIP-seq
MIRT2454531	hsa-miR-4677-5p	CLIP-seq
MIRT2574587	hsa-miR-4695-5p	CLIP-seq
MIRT2454532	hsa-miR-4700-3p	CLIP-seq
MIRT1161987	hsa-miR-4703-3p	CLIP-seq
MIRT1161988	hsa-miR-4714-5p	CLIP-seq
MIRT2574588	hsa-miR-4722-5p	CLIP-seq
MIRT1161989	hsa-miR-4781-3p	CLIP-seq
MIRT1161990	hsa-miR-4799-5p	CLIP-seq
MIRT2574591	hsa-miR-516b	CLIP-seq
MIRT1161991	hsa-miR-519a	CLIP-seq
MIRT1161992	hsa-miR-519b-3p	CLIP-seq
MIRT1161993	hsa-miR-519c-3p	CLIP-seq
MIRT1161994	hsa-miR-519d	CLIP-seq
MIRT1161995	hsa-miR-548t	CLIP-seq
MIRT1161996	hsa-miR-554	CLIP-seq
MIRT1161997	hsa-miR-576-5p	CLIP-seq
MIRT1161998	hsa-miR-601	CLIP-seq
MIRT2574593	hsa-miR-765	CLIP-seq
MIRT1162000	hsa-miR-93	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	17349998
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005829	Component	Cytosol	IDA	28554942
GO:0005829	Component	Cytosol	IDA
GO:0007005	Process	Mitochondrion organization	IBA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007005	Process	Mitochondrion organization	IMP	17349998
GO:0010636	Process	Positive regulation of mitochondrial fusion	IMP	28554942
GO:0016020	Component	Membrane	IEA
GO:0048311	Process	Mitochondrion distribution	IMP	17349998

MIM	HGNC	e!Ensembl
617619	29678	ENSG00000125459

Q9BUK6

Protein name

Protein misato homolog 1

Protein function

Involved in the regulation of mitochondrial distribution and morphology (PubMed:17349998, PubMed:28544275, PubMed:28554942). Required for mitochondrial fusion and mitochondrial network formation (PubMed:28544275, PubMed:28554942). {ECO:0000269|P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10644	Misat_Tub_SegII	6 → 120	Misato Segment II tubulin-like domain	Domain
PF14881	Tubulin_3	153 → 346	Tubulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Present in all cell lines tested (at protein level). Widely expressed. {ECO:0000269|PubMed:17349998}.

Sequence

MAGGAREVLTLQLGHFAGFVGAHWWNQQDAALGRATDSKEPPGELCPDVLYRTGRTLHGQ
ETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLS
AEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMI
QKYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSG
VGAKAAELLQDEYSGRGIITWGLLPGPYHRGEAQRNIYRLLNTAFGLVHLTAHSSLVCPL
SLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRLCSSPVSMVHLADML
SFCGKKVVTAGAIIPFPLAPGQSLPDSLMQFGGATPWTPLSACGEPSGTRCFAQSVVLRG
IDRACHTSQLTPGTPPPSALHACTTGEEILAQYLQQQQPGVMSSSHLLLTPCRVAPPYPH
LFSSCSPPGMVLDGSPKGAAVESIPVFGALCSSSSLHQTLEALARDLTKLDLRRWASFMD
AGVEHDDVAELLQELQSLAQCYQGGDSLVD

Sequence length

570

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Inborn mitochondrial myopathy	Likely pathogenic; Pathogenic	rs753488873	RCV004577353	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mitochondrial myopathy-cerebellar ataxia-pigmentary retinopathy syndrome	Likely pathogenic; Pathogenic	rs749922789, rs1553295536, rs771965165, rs1248439783, rs1208636573, rs563943670, rs753488873, rs752022363, rs745944305, rs1673545403	RCV000505818 RCV000505815 RCV000505819 RCV000768552 RCV000626042 View all (5 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital cerebellar hypoplasia	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASE	—	ClinGen, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL MYOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MSTO1-related disorder	Likely benign; Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROMUSCULAR DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (86)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15495192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	26022158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15495192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	37849306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	28554942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	28544275, 28554942, 31604776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	28767012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25307264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21104395, 26022559		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	40312366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	28544275, 31463572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	BEFREE	29339779, 31463572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	31463572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15495192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29074106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital muscular dystrophy (disorder)	Congenital muscular dystrophy	BEFREE	31130378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Deglutition disorder	Pubtator	31604776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	31604776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29846174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal amyotrophy	Distal amyotrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	31604776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29846174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29607163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31589170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	31604776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21104395, 26022559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30969006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30072378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26022559, 27221886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29074106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	28487647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	28544275, 28554942, 31463572	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	30684668		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Myopathies	Mitochondrial myopathy	Pubtator	31604776	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Myopathies	Mitochondrial myopathy	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial myopathy-cerebellar ataxia-pigmentary retinopathy syndrome	Mitochondrial Myopathy-Cerebellar Ataxia-Pigmentary Retinopathy Syndrome	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Multiple lipomata	Multiple Lipomata	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31029779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	31463572		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	26451068, 30644090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	28544275, 28554942, 30684668		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY, MITOCHONDRIAL, AND ATAXIA	Mitochondrial myopathy	GENOMICS_ENGLAND_DG	28544275, 29339779		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, MITOCHONDRIAL, AND ATAXIA	Mitochondrial myopathy	ORPHANET_DG	28544275		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, MITOCHONDRIAL, AND ATAXIA	Mitochondrial myopathy	UNIPROT_DG	28544275, 28554942		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, MITOCHONDRIAL, AND ATAXIA	Mitochondrial myopathy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27341628, 28197608, 28520570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	28554942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	28544275		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	9767613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic atrophy	Pubtator	37431816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29978257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25307264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30072378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28767012, 30053860, 31203176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	15495192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive cerebellar ataxia	Cerebellar Ataxia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive cerebellar ataxia	Cerebellar Ataxia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23047795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Receptive language delay	Receptive language delay	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29339779, 30684668, 31463572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	31463572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	30093562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	31604776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe expressive language delay	Expressive language delay	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	9668102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Visceral myopathy familial external ophthalmoplegia	Visceral neuropathy	Pubtator	31463572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MSTO1 (misato mitochondrial distribution and morphology regulator 1)