Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55143
Gene name	Cell division cycle associated 8
Gene symbol	CDCA8
Synonyms (NCBI Gene)	BORBOREALINDasraBMESRGP
Chromosome	1
Chromosome location	1p34.3
Summary	This gene encodes a component of the chromosomal passenger complex. This complex is an essential regulator of mitosis and cell division. This protein is cell-cycle regulated and is required for chromatin-induced microtubule stabilization and spindle forma

339

Show/Hide all (339)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031873	hsa-miR-16-5p	Proteomics	18668040
MIRT032429	hsa-let-7b-5p	Proteomics	18668040
MIRT046299	hsa-miR-23b-3p	CLASH	23622248
MIRT563519	hsa-miR-548n	PAR-CLIP	20371350
MIRT563518	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT563517	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT563516	hsa-miR-6507-3p	PAR-CLIP	20371350
MIRT277106	hsa-miR-371b-3p	PAR-CLIP	20371350
MIRT563515	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT277105	hsa-miR-4641	PAR-CLIP	20371350
MIRT563514	hsa-miR-3127-5p	PAR-CLIP	20371350
MIRT563519	hsa-miR-548n	PAR-CLIP	20371350
MIRT563518	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT563517	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT563516	hsa-miR-6507-3p	PAR-CLIP	20371350
MIRT277106	hsa-miR-371b-3p	PAR-CLIP	20371350
MIRT563515	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT277105	hsa-miR-4641	PAR-CLIP	20371350
MIRT563514	hsa-miR-3127-5p	PAR-CLIP	20371350
MIRT455739	hsa-miR-4779	PAR-CLIP	23592263
MIRT455740	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT455737	hsa-miR-4459	PAR-CLIP	23592263
MIRT455738	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT455736	hsa-miR-532-3p	PAR-CLIP	23592263
MIRT455734	hsa-miR-4721	PAR-CLIP	23592263
MIRT455735	hsa-miR-133a-5p	PAR-CLIP	23592263
MIRT455733	hsa-miR-6077	PAR-CLIP	23592263
MIRT455732	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT455731	hsa-miR-765	PAR-CLIP	23592263
MIRT455730	hsa-miR-4492	PAR-CLIP	23592263
MIRT455729	hsa-miR-4498	PAR-CLIP	23592263
MIRT455728	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT455727	hsa-miR-762	PAR-CLIP	23592263
MIRT340839	hsa-miR-188-3p	PAR-CLIP	23592263
MIRT455726	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT455739	hsa-miR-4779	PAR-CLIP	23592263
MIRT455740	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT455737	hsa-miR-4459	PAR-CLIP	23592263
MIRT455738	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT455736	hsa-miR-532-3p	PAR-CLIP	23592263
MIRT455734	hsa-miR-4721	PAR-CLIP	23592263
MIRT455735	hsa-miR-133a-5p	PAR-CLIP	23592263
MIRT455733	hsa-miR-6077	PAR-CLIP	23592263
MIRT455732	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT455731	hsa-miR-765	PAR-CLIP	23592263
MIRT455730	hsa-miR-4492	PAR-CLIP	23592263
MIRT455729	hsa-miR-4498	PAR-CLIP	23592263
MIRT455728	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT455727	hsa-miR-762	PAR-CLIP	23592263
MIRT340839	hsa-miR-188-3p	PAR-CLIP	23592263
MIRT455726	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT455739	hsa-miR-4779	PAR-CLIP	23592263
MIRT455740	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT455737	hsa-miR-4459	PAR-CLIP	23592263
MIRT455738	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT455736	hsa-miR-532-3p	PAR-CLIP	23592263
MIRT455734	hsa-miR-4721	PAR-CLIP	23592263
MIRT455735	hsa-miR-133a-5p	PAR-CLIP	23592263
MIRT455733	hsa-miR-6077	PAR-CLIP	23592263
MIRT455732	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT455731	hsa-miR-765	PAR-CLIP	23592263
MIRT455730	hsa-miR-4492	PAR-CLIP	23592263
MIRT455729	hsa-miR-4498	PAR-CLIP	23592263
MIRT455728	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT455727	hsa-miR-762	PAR-CLIP	23592263
MIRT340839	hsa-miR-188-3p	PAR-CLIP	23592263
MIRT455726	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT735744	hsa-miR-133a-3p	Luciferase reporter assayWestern blottingqRT-PCR	34117764
MIRT563519	hsa-miR-548n	PAR-CLIP	20371350
MIRT563518	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT563517	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT563516	hsa-miR-6507-3p	PAR-CLIP	20371350
MIRT277106	hsa-miR-371b-3p	PAR-CLIP	20371350
MIRT563515	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT277105	hsa-miR-4641	PAR-CLIP	20371350
MIRT563514	hsa-miR-3127-5p	PAR-CLIP	20371350
MIRT563519	hsa-miR-548n	PAR-CLIP	20371350
MIRT563518	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT563517	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT563516	hsa-miR-6507-3p	PAR-CLIP	20371350
MIRT277106	hsa-miR-371b-3p	PAR-CLIP	20371350
MIRT563515	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT277105	hsa-miR-4641	PAR-CLIP	20371350
MIRT563514	hsa-miR-3127-5p	PAR-CLIP	20371350
MIRT455739	hsa-miR-4779	PAR-CLIP	23592263
MIRT455740	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT455737	hsa-miR-4459	PAR-CLIP	23592263
MIRT455738	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT455736	hsa-miR-532-3p	PAR-CLIP	23592263
MIRT455734	hsa-miR-4721	PAR-CLIP	23592263
MIRT455735	hsa-miR-133a-5p	PAR-CLIP	23592263
MIRT455733	hsa-miR-6077	PAR-CLIP	23592263
MIRT455732	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT455731	hsa-miR-765	PAR-CLIP	23592263
MIRT455730	hsa-miR-4492	PAR-CLIP	23592263
MIRT455729	hsa-miR-4498	PAR-CLIP	23592263
MIRT455728	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT455727	hsa-miR-762	PAR-CLIP	23592263
MIRT340839	hsa-miR-188-3p	PAR-CLIP	23592263
MIRT455726	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT455739	hsa-miR-4779	PAR-CLIP	23592263
MIRT455740	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT455737	hsa-miR-4459	PAR-CLIP	23592263
MIRT455738	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT455736	hsa-miR-532-3p	PAR-CLIP	23592263
MIRT455734	hsa-miR-4721	PAR-CLIP	23592263
MIRT455735	hsa-miR-133a-5p	PAR-CLIP	23592263
MIRT455733	hsa-miR-6077	PAR-CLIP	23592263
MIRT455732	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT455731	hsa-miR-765	PAR-CLIP	23592263
MIRT455730	hsa-miR-4492	PAR-CLIP	23592263
MIRT455729	hsa-miR-4498	PAR-CLIP	23592263
MIRT455728	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT455727	hsa-miR-762	PAR-CLIP	23592263
MIRT340839	hsa-miR-188-3p	PAR-CLIP	23592263
MIRT455726	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT455739	hsa-miR-4779	PAR-CLIP	23592263
MIRT455740	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT455737	hsa-miR-4459	PAR-CLIP	23592263
MIRT455738	hsa-miR-140-3p	PAR-CLIP	23592263
MIRT455736	hsa-miR-532-3p	PAR-CLIP	23592263
MIRT455734	hsa-miR-4721	PAR-CLIP	23592263
MIRT455735	hsa-miR-133a-5p	PAR-CLIP	23592263
MIRT455733	hsa-miR-6077	PAR-CLIP	23592263
MIRT455732	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT455731	hsa-miR-765	PAR-CLIP	23592263
MIRT455730	hsa-miR-4492	PAR-CLIP	23592263
MIRT455729	hsa-miR-4498	PAR-CLIP	23592263
MIRT455728	hsa-miR-5001-5p	PAR-CLIP	23592263
MIRT455727	hsa-miR-762	PAR-CLIP	23592263
MIRT340839	hsa-miR-188-3p	PAR-CLIP	23592263
MIRT455726	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT879102	hsa-let-7a	CLIP-seq
MIRT879103	hsa-let-7b	CLIP-seq
MIRT879104	hsa-let-7c	CLIP-seq
MIRT879105	hsa-let-7d	CLIP-seq
MIRT879106	hsa-let-7e	CLIP-seq
MIRT879107	hsa-let-7f	CLIP-seq
MIRT879108	hsa-let-7g	CLIP-seq
MIRT879109	hsa-let-7i	CLIP-seq
MIRT879110	hsa-miR-1200	CLIP-seq
MIRT879111	hsa-miR-1207-5p	CLIP-seq
MIRT879112	hsa-miR-1265	CLIP-seq
MIRT879113	hsa-miR-1286	CLIP-seq
MIRT879114	hsa-miR-1303	CLIP-seq
MIRT879115	hsa-miR-1321	CLIP-seq
MIRT879116	hsa-miR-133a	CLIP-seq
MIRT879117	hsa-miR-133b	CLIP-seq
MIRT879118	hsa-miR-139-5p	CLIP-seq
MIRT879119	hsa-miR-141	CLIP-seq
MIRT879120	hsa-miR-146a	CLIP-seq
MIRT879121	hsa-miR-146b-5p	CLIP-seq
MIRT879122	hsa-miR-1827	CLIP-seq
MIRT879123	hsa-miR-200a	CLIP-seq
MIRT879124	hsa-miR-204	CLIP-seq
MIRT879125	hsa-miR-21	CLIP-seq
MIRT879126	hsa-miR-211	CLIP-seq
MIRT879127	hsa-miR-219-1-3p	CLIP-seq
MIRT879128	hsa-miR-2682	CLIP-seq
MIRT879129	hsa-miR-3064-5p	CLIP-seq
MIRT879130	hsa-miR-30a	CLIP-seq
MIRT879131	hsa-miR-30b	CLIP-seq
MIRT879132	hsa-miR-30c	CLIP-seq
MIRT879133	hsa-miR-30d	CLIP-seq
MIRT879134	hsa-miR-30e	CLIP-seq
MIRT879135	hsa-miR-3125	CLIP-seq
MIRT879136	hsa-miR-3132	CLIP-seq
MIRT879137	hsa-miR-3135b	CLIP-seq
MIRT879138	hsa-miR-3140-5p	CLIP-seq
MIRT879139	hsa-miR-3162-5p	CLIP-seq
MIRT879140	hsa-miR-3169	CLIP-seq
MIRT879141	hsa-miR-3194-3p	CLIP-seq
MIRT879142	hsa-miR-3529	CLIP-seq
MIRT879143	hsa-miR-3605-5p	CLIP-seq
MIRT879144	hsa-miR-3612	CLIP-seq
MIRT879145	hsa-miR-3617	CLIP-seq
MIRT879146	hsa-miR-3618	CLIP-seq
MIRT879147	hsa-miR-3619-3p	CLIP-seq
MIRT879148	hsa-miR-3652	CLIP-seq
MIRT879149	hsa-miR-3654	CLIP-seq
MIRT879150	hsa-miR-3662	CLIP-seq
MIRT879151	hsa-miR-3689d	CLIP-seq
MIRT879152	hsa-miR-3692	CLIP-seq
MIRT879153	hsa-miR-370	CLIP-seq
MIRT879154	hsa-miR-379	CLIP-seq
MIRT879155	hsa-miR-382	CLIP-seq
MIRT879156	hsa-miR-3916	CLIP-seq
MIRT879157	hsa-miR-3925-3p	CLIP-seq
MIRT879158	hsa-miR-3927	CLIP-seq
MIRT879159	hsa-miR-3928	CLIP-seq
MIRT879160	hsa-miR-3938	CLIP-seq
MIRT879161	hsa-miR-4251	CLIP-seq
MIRT879162	hsa-miR-4324	CLIP-seq
MIRT879163	hsa-miR-4430	CLIP-seq
MIRT879164	hsa-miR-4436b-3p	CLIP-seq
MIRT879165	hsa-miR-4436b-5p	CLIP-seq
MIRT879166	hsa-miR-4448	CLIP-seq
MIRT879167	hsa-miR-4452	CLIP-seq
MIRT879168	hsa-miR-4458	CLIP-seq
MIRT879169	hsa-miR-449c	CLIP-seq
MIRT879170	hsa-miR-4500	CLIP-seq
MIRT879171	hsa-miR-4505	CLIP-seq
MIRT879172	hsa-miR-451b	CLIP-seq
MIRT879173	hsa-miR-452	CLIP-seq
MIRT879174	hsa-miR-4637	CLIP-seq
MIRT879175	hsa-miR-4650-3p	CLIP-seq
MIRT879176	hsa-miR-4676-3p	CLIP-seq
MIRT879177	hsa-miR-4680-3p	CLIP-seq
MIRT879178	hsa-miR-4685-5p	CLIP-seq
MIRT879179	hsa-miR-4695-5p	CLIP-seq
MIRT879180	hsa-miR-4696	CLIP-seq
MIRT879181	hsa-miR-4700-3p	CLIP-seq
MIRT879182	hsa-miR-4722-5p	CLIP-seq
MIRT879183	hsa-miR-4723-5p	CLIP-seq
MIRT879184	hsa-miR-4736	CLIP-seq
MIRT879185	hsa-miR-4739	CLIP-seq
MIRT879186	hsa-miR-4755-5p	CLIP-seq
MIRT879187	hsa-miR-4756-5p	CLIP-seq
MIRT879188	hsa-miR-4763-3p	CLIP-seq
MIRT879189	hsa-miR-4771	CLIP-seq
MIRT879190	hsa-miR-4773	CLIP-seq
MIRT879191	hsa-miR-4776-5p	CLIP-seq
MIRT879192	hsa-miR-4802-3p	CLIP-seq
MIRT879193	hsa-miR-4803	CLIP-seq
MIRT879194	hsa-miR-483-5p	CLIP-seq
MIRT879195	hsa-miR-485-5p	CLIP-seq
MIRT879196	hsa-miR-490-5p	CLIP-seq
MIRT879197	hsa-miR-499a-5p	CLIP-seq
MIRT879198	hsa-miR-513a-3p	CLIP-seq
MIRT879199	hsa-miR-515-5p	CLIP-seq
MIRT879200	hsa-miR-522	CLIP-seq
MIRT879201	hsa-miR-544b	CLIP-seq
MIRT879202	hsa-miR-571	CLIP-seq
MIRT879203	hsa-miR-589	CLIP-seq
MIRT879204	hsa-miR-590-5p	CLIP-seq
MIRT879205	hsa-miR-591	CLIP-seq
MIRT879206	hsa-miR-623	CLIP-seq
MIRT879207	hsa-miR-641	CLIP-seq
MIRT879208	hsa-miR-650	CLIP-seq
MIRT879209	hsa-miR-766	CLIP-seq
MIRT879210	hsa-miR-877	CLIP-seq
MIRT879211	hsa-miR-98	CLIP-seq
MIRT1546361	hsa-miR-1	CLIP-seq
MIRT1546362	hsa-miR-206	CLIP-seq
MIRT1546363	hsa-miR-3673	CLIP-seq
MIRT1546364	hsa-miR-4717-3p	CLIP-seq
MIRT1546365	hsa-miR-4717-5p	CLIP-seq
MIRT879192	hsa-miR-4802-3p	CLIP-seq
MIRT1546366	hsa-miR-613	CLIP-seq
MIRT1960618	hsa-miR-125a-3p	CLIP-seq
MIRT1960619	hsa-miR-1285	CLIP-seq
MIRT879115	hsa-miR-1321	CLIP-seq
MIRT1960620	hsa-miR-214	CLIP-seq
MIRT1960621	hsa-miR-3156-3p	CLIP-seq
MIRT1960622	hsa-miR-3187-5p	CLIP-seq
MIRT1960623	hsa-miR-3619-5p	CLIP-seq
MIRT1960624	hsa-miR-3665	CLIP-seq
MIRT1960625	hsa-miR-4301	CLIP-seq
MIRT879185	hsa-miR-4739	CLIP-seq
MIRT879187	hsa-miR-4756-5p	CLIP-seq
MIRT879192	hsa-miR-4802-3p	CLIP-seq
MIRT879198	hsa-miR-513a-3p	CLIP-seq
MIRT1960626	hsa-miR-582-5p	CLIP-seq
MIRT1960627	hsa-miR-612	CLIP-seq
MIRT1960628	hsa-miR-761	CLIP-seq
MIRT879102	hsa-let-7a	CLIP-seq
MIRT879103	hsa-let-7b	CLIP-seq
MIRT879104	hsa-let-7c	CLIP-seq
MIRT879105	hsa-let-7d	CLIP-seq
MIRT879106	hsa-let-7e	CLIP-seq
MIRT879107	hsa-let-7f	CLIP-seq
MIRT879108	hsa-let-7g	CLIP-seq
MIRT879109	hsa-let-7i	CLIP-seq
MIRT2197291	hsa-miR-1207-3p	CLIP-seq
MIRT879111	hsa-miR-1207-5p	CLIP-seq
MIRT879114	hsa-miR-1303	CLIP-seq
MIRT879115	hsa-miR-1321	CLIP-seq
MIRT879116	hsa-miR-133a	CLIP-seq
MIRT879117	hsa-miR-133b	CLIP-seq
MIRT2197292	hsa-miR-134	CLIP-seq
MIRT879118	hsa-miR-139-5p	CLIP-seq
MIRT879119	hsa-miR-141	CLIP-seq
MIRT879123	hsa-miR-200a	CLIP-seq
MIRT879124	hsa-miR-204	CLIP-seq
MIRT879125	hsa-miR-21	CLIP-seq
MIRT879126	hsa-miR-211	CLIP-seq
MIRT2197293	hsa-miR-2278	CLIP-seq
MIRT879130	hsa-miR-30a	CLIP-seq
MIRT879131	hsa-miR-30b	CLIP-seq
MIRT879132	hsa-miR-30c	CLIP-seq
MIRT879133	hsa-miR-30d	CLIP-seq
MIRT879134	hsa-miR-30e	CLIP-seq
MIRT2197294	hsa-miR-3118	CLIP-seq
MIRT879139	hsa-miR-3162-5p	CLIP-seq
MIRT879145	hsa-miR-3617	CLIP-seq
MIRT879152	hsa-miR-3692	CLIP-seq
MIRT879155	hsa-miR-382	CLIP-seq
MIRT2197295	hsa-miR-3920	CLIP-seq
MIRT2197296	hsa-miR-3926	CLIP-seq
MIRT879158	hsa-miR-3927	CLIP-seq
MIRT2197297	hsa-miR-4267	CLIP-seq
MIRT879165	hsa-miR-4436b-5p	CLIP-seq
MIRT879168	hsa-miR-4458	CLIP-seq
MIRT879170	hsa-miR-4500	CLIP-seq
MIRT2197298	hsa-miR-450b-3p	CLIP-seq
MIRT2197299	hsa-miR-4519	CLIP-seq
MIRT879172	hsa-miR-451b	CLIP-seq
MIRT879174	hsa-miR-4637	CLIP-seq
MIRT879175	hsa-miR-4650-3p	CLIP-seq
MIRT879180	hsa-miR-4696	CLIP-seq
MIRT2197300	hsa-miR-4713-3p	CLIP-seq
MIRT879185	hsa-miR-4739	CLIP-seq
MIRT879186	hsa-miR-4755-5p	CLIP-seq
MIRT879187	hsa-miR-4756-5p	CLIP-seq
MIRT879188	hsa-miR-4763-3p	CLIP-seq
MIRT879190	hsa-miR-4773	CLIP-seq
MIRT2197301	hsa-miR-4778-5p	CLIP-seq
MIRT879192	hsa-miR-4802-3p	CLIP-seq
MIRT879193	hsa-miR-4803	CLIP-seq
MIRT879197	hsa-miR-499a-5p	CLIP-seq
MIRT879198	hsa-miR-513a-3p	CLIP-seq
MIRT879199	hsa-miR-515-5p	CLIP-seq
MIRT2197302	hsa-miR-548aa	CLIP-seq
MIRT2197303	hsa-miR-548s	CLIP-seq
MIRT879204	hsa-miR-590-5p	CLIP-seq
MIRT879206	hsa-miR-623	CLIP-seq
MIRT2197304	hsa-miR-634	CLIP-seq
MIRT2197305	hsa-miR-638	CLIP-seq
MIRT879207	hsa-miR-641	CLIP-seq
MIRT2197306	hsa-miR-663b	CLIP-seq
MIRT2197307	hsa-miR-769-3p	CLIP-seq
MIRT879211	hsa-miR-98	CLIP-seq
MIRT879125	hsa-miR-21	CLIP-seq
MIRT2197296	hsa-miR-3926	CLIP-seq
MIRT2197301	hsa-miR-4778-5p	CLIP-seq
MIRT2197302	hsa-miR-548aa	CLIP-seq
MIRT2197303	hsa-miR-548s	CLIP-seq
MIRT879204	hsa-miR-590-5p	CLIP-seq
MIRT2197306	hsa-miR-663b	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IBA
GO:0000278	Process	Mitotic cell cycle	NAS	17956729
GO:0000281	Process	Mitotic cytokinesis	NAS	17956729
GO:0000775	Component	Chromosome, centromeric region	IBA
GO:0000775	Component	Chromosome, centromeric region	IDA	15260989
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0005515	Function	Protein binding	IPI	16239925, 16291752, 17099693, 17956729, 18243099, 20739936, 21051298, 24571573, 25416956, 28514442, 29568061, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	15260989
GO:0010369	Component	Chromocenter	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA	9859993
GO:0030496	Component	Midbody	IDA	22724069
GO:0032133	Component	Chromosome passenger complex	IBA
GO:0032133	Component	Chromosome passenger complex	IPI	15260989, 17956729, 18591255
GO:0032991	Component	Protein-containing complex	IDA	16239925
GO:0045171	Component	Intercellular bridge	IDA
GO:0051233	Component	Spindle midzone	IBA
GO:0051256	Process	Mitotic spindle midzone assembly	NAS	17956729
GO:0051276	Process	Chromosome organization	IMP	15260989
GO:0051301	Process	Cell division	IEA
GO:0090267	Process	Positive regulation of mitotic cell cycle spindle assembly checkpoint	NAS	17956729
GO:0090307	Process	Mitotic spindle assembly	NAS	17956729
GO:1901970	Process	Positive regulation of mitotic sister chromatid separation	NAS	17956729
GO:1902425	Process	Positive regulation of attachment of mitotic spindle microtubules to kinetochore	NAS	17956729
GO:1903490	Process	Positive regulation of mitotic cytokinesis	NAS	17956729

MIM	HGNC	e!Ensembl
609977	14629	ENSG00000134690

Q53HL2

Protein name

Borealin (Cell division cycle-associated protein 8) (Dasra-B) (hDasra-B) (Pluripotent embryonic stem cell-related gene 3 protein)

Protein function

Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chrom

PDB

2KDD , 2QFA , 2RAW , 2RAX , 6YIE , 6YIF , 6YIH , 7U5V , 8RUP , 8RUQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10444	Nbl1_Borealin_N	20 → 76	Nbl1 / Borealin N terminal	Family
PF10512	Borealin	163 → 275	Cell division cycle-associated protein 8	Family

Sequence

MAPRKGSSRVAKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILR
LPKALREMNWLDYFALGGNKQALEEAATADLDITEINKLTAEAIQTPLKSAKTRKVIQVD
EMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVS
MVKPTPGLTPRFDSRVFKTPGLRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLR
LLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK

Sequence length

280

Interactions

View interactions

	Reactome
			Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion SUMOylation of DNA replication proteins RHO GTPases Activate Formins Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CDCA8-related condition	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutrophil inclusion bodies	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (59)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	32923148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	37945831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	23979607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23979607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	20695804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Branchio-Oto-Renal Syndrome	Branchiootorenal Syndrome	BEFREE	8786145, 8824802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29467944, 30953709, 31281726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31285741, 33285689, 35456460, 37713876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	9556298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32887635, 34112092, 34116652, 34523732, 34897268, 36855818, 37059592, 37945831, 38057871, 40465781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17483322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28260099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32685473, 35603384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	36186000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17243165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17243165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	6700618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital Hypothyroidism	GENOMICS_ENGLAND_DG	29546359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	30431060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23979607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36186000, 37853361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36085568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33449451	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39528802, 40114265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35676807	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35774141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	7849713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32887635, 37813876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17483322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31506038, 35608130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32130760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29467944, 30953709, 31281726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17483322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31031850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26170459, 30142792, 30431060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17243165		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30431060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	30431060	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23979607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30142792, 31686241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26096802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33153400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	36186000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22174824, 34253236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31031850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32130760, 35094010, 35119046, 35168617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Dysplasia	Renal dysplasia	BEFREE	6964893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	BEFREE	6964893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32716971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16427043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34082692	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	33455115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Dysgenesis	Thyroid Dysgenesis	BEFREE	28025328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Dysgenesis	Thyroid Dysgenesis	GENOMICS_ENGLAND_DG	29546359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30142792	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32677673, 37813876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	30664180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CDCA8 (cell division cycle associated 8)