Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55114
Gene name	Rho GTPase activating protein 17
Gene symbol	ARHGAP17
Synonyms (NCBI Gene)	MST066MST110MSTP038MSTP066MSTP110NADRINPP367PP4534RICH-1RICH1WBP15
Chromosome	16
Chromosome location	16p12.1
Summary	RICH1 is a GTPase-activating protein (GAP). GAPs stimulate the intrinsic GTP hydrolysis of small G proteins, such as RHOA (MIM 165390), RAC1 (MIM 602048), and CDC42 (MIM 116952).[supplied by OMIM, Apr 2004]

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032476	hsa-let-7b-5p	Proteomics	18668040
MIRT050323	hsa-miR-25-3p	CLASH	23622248
MIRT044803	hsa-miR-320a	CLASH	23622248
MIRT042883	hsa-miR-324-3p	CLASH	23622248
MIRT441202	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441202	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT793872	hsa-miR-1297	CLIP-seq
MIRT793873	hsa-miR-181a	CLIP-seq
MIRT793874	hsa-miR-181b	CLIP-seq
MIRT793875	hsa-miR-181c	CLIP-seq
MIRT793876	hsa-miR-181d	CLIP-seq
MIRT793877	hsa-miR-214	CLIP-seq
MIRT793878	hsa-miR-26a	CLIP-seq
MIRT793879	hsa-miR-26b	CLIP-seq
MIRT793880	hsa-miR-3120-5p	CLIP-seq
MIRT793881	hsa-miR-3150a-3p	CLIP-seq
MIRT793882	hsa-miR-3175	CLIP-seq
MIRT793883	hsa-miR-3184	CLIP-seq
MIRT793884	hsa-miR-3199	CLIP-seq
MIRT793885	hsa-miR-337-3p	CLIP-seq
MIRT793886	hsa-miR-3618	CLIP-seq
MIRT793887	hsa-miR-3619-5p	CLIP-seq
MIRT793888	hsa-miR-3622b-5p	CLIP-seq
MIRT793889	hsa-miR-3908	CLIP-seq
MIRT793890	hsa-miR-3942-5p	CLIP-seq
MIRT793891	hsa-miR-3945	CLIP-seq
MIRT793892	hsa-miR-423-5p	CLIP-seq
MIRT793893	hsa-miR-4253	CLIP-seq
MIRT793894	hsa-miR-4262	CLIP-seq
MIRT793895	hsa-miR-4274	CLIP-seq
MIRT793896	hsa-miR-4275	CLIP-seq
MIRT793897	hsa-miR-4291	CLIP-seq
MIRT793898	hsa-miR-4303	CLIP-seq
MIRT793899	hsa-miR-4304	CLIP-seq
MIRT793900	hsa-miR-4465	CLIP-seq
MIRT793901	hsa-miR-4515	CLIP-seq
MIRT793902	hsa-miR-4530	CLIP-seq
MIRT793903	hsa-miR-4649-3p	CLIP-seq
MIRT793904	hsa-miR-4652-3p	CLIP-seq
MIRT793905	hsa-miR-4652-5p	CLIP-seq
MIRT793906	hsa-miR-4667-5p	CLIP-seq
MIRT793907	hsa-miR-4700-5p	CLIP-seq
MIRT793908	hsa-miR-4703-5p	CLIP-seq
MIRT793909	hsa-miR-4704-3p	CLIP-seq
MIRT793910	hsa-miR-4746-5p	CLIP-seq
MIRT793911	hsa-miR-4766-3p	CLIP-seq
MIRT793912	hsa-miR-4787-3p	CLIP-seq
MIRT793913	hsa-miR-516a-3p	CLIP-seq
MIRT793914	hsa-miR-562	CLIP-seq
MIRT793915	hsa-miR-761	CLIP-seq
MIRT793916	hsa-miR-922	CLIP-seq
MIRT793917	hsa-miR-934	CLIP-seq
MIRT793918	hsa-miR-939	CLIP-seq
MIRT2174107	hsa-miR-145	CLIP-seq
MIRT793877	hsa-miR-214	CLIP-seq
MIRT793887	hsa-miR-3619-5p	CLIP-seq
MIRT793888	hsa-miR-3622b-5p	CLIP-seq
MIRT793895	hsa-miR-4274	CLIP-seq
MIRT793899	hsa-miR-4304	CLIP-seq
MIRT793902	hsa-miR-4530	CLIP-seq
MIRT793909	hsa-miR-4704-3p	CLIP-seq
MIRT2174108	hsa-miR-542-3p	CLIP-seq
MIRT793915	hsa-miR-761	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	21481793, 25416956, 28514442, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0035020	Process	Regulation of Rac protein signal transduction	IBA
GO:0051058	Process	Negative regulation of small GTPase mediated signal transduction	IBA
GO:0070161	Component	Anchoring junction	IEA

MIM	HGNC	e!Ensembl
608293	18239	ENSG00000140750

Q68EM7

Protein name

Rho GTPase-activating protein 17 (Rho-type GTPase-activating protein 17) (RhoGAP interacting with CIP4 homologs protein 1) (RICH-1)

Protein function

Rho GTPase-activating protein involved in the maintenance of tight junction by regulating the activity of CDC42, thereby playing a central role in apical polarity of epithelial cells. Specifically acts as a GTPase activator for the CDC42 GTPase

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03114	BAR	1 → 239	BAR domain	Domain
PF00620	RhoGAP	266 → 416	RhoGAP domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Expressed at higher level in heart and placenta. {ECO:0000269|PubMed:11431473}.

Sequence

MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSICHHSHKRLVACFQGQHGT
DAERRHKKLPLTALAQNMQEASTQLEDSLLGKMLETCGDAENQLALELSQHEVFVEKEIV
DPLYGIAEVEIPNIQKQRKQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEM
DEAGNKVEQCKDQLAADMYNFMAKEGEYGKFFVTLLEAQADYHRKALAVLEKTLPEMRAH
QDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKKLK
AALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDL
WRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWARNEGTLAEMA
AATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLTTPSSNHSFHTGNDSDSGTLERK
RPASMAVMEGDLVKKESFGVKLMDFQAHRRGGTLNRKHISPAFQPPLPPTDGSTVVPAGP
EPPPQSSRAESSSGGGTVPSSAGILEQGPSPGDGSPPKPKDPVSAAVPAPGRNNSQIASG
QNQPQAAAGSHQLSMGQPHNAAGPSPHTLRRAVKKPAPAPPKPGNPPPGHPGGQSSSGTS
QHPPSLSPKPPTRSPSPPTQHTGQPPGQPSAPSQLSAPRRYSSSLSPIQAPNHPPPQPPT
QATPLMHTKPNSQGPPNPMALPSEHGLEQPSHTPPQTPTPPSTPPLGKQNPSLPAPQTLA
GGNPETAQPHAGTLPRPRPVPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDS
NSRVSEPHRSIFPEMHSDSASKDVPGRILLDIDNDTESTAL

Sequence length

881

Interactions

View interactions

	KEGG		Reactome
	Tight junction		Rho GTPase cycle

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	29971782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29971782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35064101	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29730655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30641218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30641218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29730655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29730655	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	29730655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29971782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29730655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30641218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29730655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29730655, 30641218		★★★★★ ★☆☆☆☆ Found in Text Mining only

ARHGAP17 (Rho GTPase activating protein 17)