Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55109
Gene name	Angiogenic factor with G-patch and FHA domains 1
Gene symbol	AGGF1
Synonyms (NCBI Gene)	GPATC7GPATCH7HSU84971HUS84971VG5Q
Chromosome	5
Chromosome location	5q13.3
Summary	This gene encodes an angiogenic factor that promotes proliferation of endothelial cells. Mutations in this gene are associated with a susceptibility to Klippel-Trenaunay syndrome. Pseudogenes of this gene are found on chromosomes 3, 4, 10 and 16.[provided

166

Show/Hide all (166)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019345	hsa-miR-148b-3p	Microarray	17612493
MIRT030831	hsa-miR-21-5p	Microarray	18591254
MIRT049919	hsa-miR-30a-3p	CLASH	23622248
MIRT037003	hsa-miR-877-3p	CLASH	23622248
MIRT097311	hsa-miR-4307	PAR-CLIP	22100165
MIRT446935	hsa-miR-95-5p	PAR-CLIP	22100165
MIRT446934	hsa-miR-27b-5p	PAR-CLIP	22100165
MIRT446933	hsa-miR-5008-5p	PAR-CLIP	22100165
MIRT446932	hsa-miR-6089	PAR-CLIP	22100165
MIRT446931	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446929	hsa-miR-6765-5p	PAR-CLIP	22100165
MIRT446930	hsa-miR-1304-5p	PAR-CLIP	22100165
MIRT446928	hsa-miR-1305	PAR-CLIP	22100165
MIRT446935	hsa-miR-95-5p	PAR-CLIP	22100165
MIRT446934	hsa-miR-27b-5p	PAR-CLIP	22100165
MIRT446933	hsa-miR-5008-5p	PAR-CLIP	22100165
MIRT446932	hsa-miR-6089	PAR-CLIP	22100165
MIRT446931	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446929	hsa-miR-6765-5p	PAR-CLIP	22100165
MIRT446930	hsa-miR-1304-5p	PAR-CLIP	22100165
MIRT446928	hsa-miR-1305	PAR-CLIP	22100165
MIRT097311	hsa-miR-4307	PAR-CLIP	22100165
MIRT446935	hsa-miR-95-5p	PAR-CLIP	22100165
MIRT446934	hsa-miR-27b-5p	PAR-CLIP	22100165
MIRT446933	hsa-miR-5008-5p	PAR-CLIP	22100165
MIRT446932	hsa-miR-6089	PAR-CLIP	22100165
MIRT446931	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446929	hsa-miR-6765-5p	PAR-CLIP	22100165
MIRT446930	hsa-miR-1304-5p	PAR-CLIP	22100165
MIRT446928	hsa-miR-1305	PAR-CLIP	22100165
MIRT446935	hsa-miR-95-5p	PAR-CLIP	22100165
MIRT446934	hsa-miR-27b-5p	PAR-CLIP	22100165
MIRT446933	hsa-miR-5008-5p	PAR-CLIP	22100165
MIRT446932	hsa-miR-6089	PAR-CLIP	22100165
MIRT446931	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446929	hsa-miR-6765-5p	PAR-CLIP	22100165
MIRT446930	hsa-miR-1304-5p	PAR-CLIP	22100165
MIRT446928	hsa-miR-1305	PAR-CLIP	22100165
MIRT771979	hsa-miR-101	CLIP-seq
MIRT771980	hsa-miR-10a	CLIP-seq
MIRT771981	hsa-miR-10b	CLIP-seq
MIRT771982	hsa-miR-1226	CLIP-seq
MIRT771983	hsa-miR-1227	CLIP-seq
MIRT771984	hsa-miR-1273d	CLIP-seq
MIRT771985	hsa-miR-144	CLIP-seq
MIRT771986	hsa-miR-145	CLIP-seq
MIRT771987	hsa-miR-151-3p	CLIP-seq
MIRT771988	hsa-miR-181a	CLIP-seq
MIRT771989	hsa-miR-181b	CLIP-seq
MIRT771990	hsa-miR-181c	CLIP-seq
MIRT771991	hsa-miR-181d	CLIP-seq
MIRT771992	hsa-miR-1825	CLIP-seq
MIRT771993	hsa-miR-1914	CLIP-seq
MIRT771994	hsa-miR-199a-5p	CLIP-seq
MIRT771995	hsa-miR-199b-5p	CLIP-seq
MIRT771996	hsa-miR-223	CLIP-seq
MIRT771997	hsa-miR-27a	CLIP-seq
MIRT771998	hsa-miR-27b	CLIP-seq
MIRT771999	hsa-miR-29a	CLIP-seq
MIRT772000	hsa-miR-29b	CLIP-seq
MIRT772001	hsa-miR-29c	CLIP-seq
MIRT772002	hsa-miR-3065-3p	CLIP-seq
MIRT772003	hsa-miR-3591-3p	CLIP-seq
MIRT772004	hsa-miR-3605-3p	CLIP-seq
MIRT772005	hsa-miR-376c	CLIP-seq
MIRT772006	hsa-miR-412	CLIP-seq
MIRT772007	hsa-miR-4262	CLIP-seq
MIRT772008	hsa-miR-4277	CLIP-seq
MIRT772009	hsa-miR-4420	CLIP-seq
MIRT772010	hsa-miR-4427	CLIP-seq
MIRT772011	hsa-miR-4463	CLIP-seq
MIRT772012	hsa-miR-4499	CLIP-seq
MIRT772013	hsa-miR-4637	CLIP-seq
MIRT772014	hsa-miR-4728-3p	CLIP-seq
MIRT772015	hsa-miR-513a-5p	CLIP-seq
MIRT772016	hsa-miR-548u	CLIP-seq
MIRT772017	hsa-miR-570	CLIP-seq
MIRT772018	hsa-miR-587	CLIP-seq
MIRT772019	hsa-miR-606	CLIP-seq
MIRT772020	hsa-miR-634	CLIP-seq
MIRT772021	hsa-miR-875-3p	CLIP-seq
MIRT1927806	hsa-miR-1283	CLIP-seq
MIRT771986	hsa-miR-145	CLIP-seq
MIRT771992	hsa-miR-1825	CLIP-seq
MIRT1927807	hsa-miR-1912	CLIP-seq
MIRT771993	hsa-miR-1914	CLIP-seq
MIRT771994	hsa-miR-199a-5p	CLIP-seq
MIRT771995	hsa-miR-199b-5p	CLIP-seq
MIRT1927808	hsa-miR-2110	CLIP-seq
MIRT771996	hsa-miR-223	CLIP-seq
MIRT771997	hsa-miR-27a	CLIP-seq
MIRT771998	hsa-miR-27b	CLIP-seq
MIRT1927809	hsa-miR-3121-3p	CLIP-seq
MIRT1927810	hsa-miR-3150a-3p	CLIP-seq
MIRT1927811	hsa-miR-3175	CLIP-seq
MIRT1927812	hsa-miR-338-5p	CLIP-seq
MIRT1927813	hsa-miR-34b	CLIP-seq
MIRT1927814	hsa-miR-3613-3p	CLIP-seq
MIRT1927815	hsa-miR-3688-3p	CLIP-seq
MIRT772006	hsa-miR-412	CLIP-seq
MIRT1927816	hsa-miR-4260	CLIP-seq
MIRT772008	hsa-miR-4277	CLIP-seq
MIRT772009	hsa-miR-4420	CLIP-seq
MIRT1927817	hsa-miR-4443	CLIP-seq
MIRT1927818	hsa-miR-4639-3p	CLIP-seq
MIRT1927819	hsa-miR-4716-5p	CLIP-seq
MIRT1927820	hsa-miR-4775	CLIP-seq
MIRT772015	hsa-miR-513a-5p	CLIP-seq
MIRT1927821	hsa-miR-548c-3p	CLIP-seq
MIRT1927822	hsa-miR-548p	CLIP-seq
MIRT1927823	hsa-miR-590-3p	CLIP-seq
MIRT1927824	hsa-miR-615-5p	CLIP-seq
MIRT1927825	hsa-miR-633	CLIP-seq
MIRT1927826	hsa-miR-656	CLIP-seq
MIRT1927827	hsa-miR-660	CLIP-seq
MIRT1927828	hsa-miR-939	CLIP-seq
MIRT772003	hsa-miR-3591-3p	CLIP-seq
MIRT2168700	hsa-miR-4317	CLIP-seq
MIRT2168701	hsa-miR-4763-5p	CLIP-seq
MIRT772018	hsa-miR-587	CLIP-seq
MIRT1927825	hsa-miR-633	CLIP-seq
MIRT1927826	hsa-miR-656	CLIP-seq
MIRT2384000	hsa-miR-1185	CLIP-seq
MIRT2384001	hsa-miR-1224-5p	CLIP-seq
MIRT2384002	hsa-miR-1265	CLIP-seq
MIRT1927807	hsa-miR-1912	CLIP-seq
MIRT1927809	hsa-miR-3121-3p	CLIP-seq
MIRT2384003	hsa-miR-3605-5p	CLIP-seq
MIRT2384004	hsa-miR-3679-5p	CLIP-seq
MIRT1927815	hsa-miR-3688-3p	CLIP-seq
MIRT2384005	hsa-miR-3915	CLIP-seq
MIRT2384006	hsa-miR-4689	CLIP-seq
MIRT771979	hsa-miR-101	CLIP-seq
MIRT1927806	hsa-miR-1283	CLIP-seq
MIRT771985	hsa-miR-144	CLIP-seq
MIRT771997	hsa-miR-27a	CLIP-seq
MIRT771998	hsa-miR-27b	CLIP-seq
MIRT1927812	hsa-miR-338-5p	CLIP-seq
MIRT772005	hsa-miR-376c	CLIP-seq
MIRT772006	hsa-miR-412	CLIP-seq
MIRT772010	hsa-miR-4427	CLIP-seq
MIRT772014	hsa-miR-4728-3p	CLIP-seq
MIRT2471193	hsa-miR-4735-5p	CLIP-seq
MIRT1927820	hsa-miR-4775	CLIP-seq
MIRT2471194	hsa-miR-494	CLIP-seq
MIRT2471195	hsa-miR-495	CLIP-seq
MIRT772015	hsa-miR-513a-5p	CLIP-seq
MIRT772016	hsa-miR-548u	CLIP-seq
MIRT772017	hsa-miR-570	CLIP-seq
MIRT1927823	hsa-miR-590-3p	CLIP-seq
MIRT1927806	hsa-miR-1283	CLIP-seq
MIRT2674704	hsa-miR-1323	CLIP-seq
MIRT1927807	hsa-miR-1912	CLIP-seq
MIRT2674705	hsa-miR-2276	CLIP-seq
MIRT1927809	hsa-miR-3121-3p	CLIP-seq
MIRT2674706	hsa-miR-3672	CLIP-seq
MIRT1927815	hsa-miR-3688-3p	CLIP-seq
MIRT2674707	hsa-miR-3936	CLIP-seq
MIRT2168700	hsa-miR-4317	CLIP-seq
MIRT2674708	hsa-miR-4760-5p	CLIP-seq
MIRT2168701	hsa-miR-4763-5p	CLIP-seq
MIRT2674709	hsa-miR-4772-3p	CLIP-seq
MIRT2674710	hsa-miR-518a-5p	CLIP-seq
MIRT2674711	hsa-miR-527	CLIP-seq
MIRT2674712	hsa-miR-548o	CLIP-seq
MIRT2674713	hsa-miR-629	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
GATA1	Activation	19556247

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001570	Process	Vasculogenesis	TAS	15905966
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	14961121
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005515	Function	Protein binding	IPI	14961121, 16189514, 31515488, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	IDA	14961121
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IDA	14961121
GO:0005737	Component	Cytoplasm	IEA
GO:0007155	Process	Cell adhesion	IDA	14961121
GO:0030154	Process	Cell differentiation	IEA
GO:0042802	Function	Identical protein binding	IPI	22365833, 25416956, 39251607
GO:0045766	Process	Positive regulation of angiogenesis	IBA
GO:0045766	Process	Positive regulation of angiogenesis	IDA	14961121
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	14961121

MIM	HGNC	e!Ensembl
608464	24684	ENSG00000164252

Q8N302

Protein name

Angiogenic factor with G patch and FHA domains 1 (Angiogenic factor VG5Q) (hVG5Q) (G patch domain-containing protein 7) (Vasculogenesis gene on 5q protein)

Protein function

Promotes angiogenesis and the proliferation of endothelial cells. Able to bind to endothelial cells and promote cell proliferation, suggesting that it may act in an autocrine fashion.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17780	OCRE	203 → 254	OCRE domain	Domain
PF00498	FHA	434 → 508	FHA domain	Family
PF01585	G-patch	619 → 662	G-patch domain	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in endothelial cells, vascular smooth muscle cells and osteoblasts. Expressed in umbilical vein endothelial cells and microvascular endothelial cells. {ECO:0000269|PubMed:14961121}.

Sequence

MASEAPSPPRSPPPPTSPEPELAQLRRKVEKLERELRSCKRQVREIEKLLHHTERLYQNA
ESNNQELRTQVEELSKILQRGRNEDNKKSDVEVQTENHAPWSISDYFYQTYYNDVSLPNK
VTELSDQQDQAIETSILNSKDHLQVENDAYPGTDRTENVKYRQVDHFASNSQEPASALAT
EDTSLEGSSLAESLRAAAEAAVSQTGFSYDENTGLYFDHSTGFYYDSENQLYYDPSTGIY
YYCDVESGRYQFHSRVDLQPYPTSSTKQSKDKKLKKKRKDPDSSATNEEKDLNSEDQKAF
SVEHTSCNEEENFANMKKKAKIGIHHKNSPPKVTVPTSGNTIESPLHENISNSTSFKDEK
IMETDSEPEEGEITDSQTEDSYDEAITSEGNVTAEDSEDEDEDKIWPPCIRVIVIRSPVL
QIGSLFIITAVNPATIGREKDMEHTLRIPEVGVSKFHAEIYFDHDLQSYVLVDQGSQNGT
IVNGKQILQPKTKCDPYVLEHGDEVKIGETVLSFHIHPGSDTCDGCEPGQVRAHLRLDKK
DESFVGPTLSKEEKELERRKELKKIRVKYGLQNTEYEDEKTLKNPKYKDRAGKRREQVGS
EGTFQRDDAPASVHSEITDSNKGRKMLEKMGWKKGEGLGKDGGGMKTPIQLQLRRTHAGL
GTGKPSSFEDVHLLQNKNKKNWDKARERFTENFPETKPQKDDPGTMPWVKGTLE

Sequence length

714

Interactions

View interactions

	Reactome
			Signaling by BRAF and RAF fusions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Non-syndromic syndactyly	Likely pathogenic	rs781603465	RCV002302837	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CAPILLARY-LYMPHATIC-VENOUS MALFORMATION WITH SEGMENTAL DISTRIBUTION	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KLIPPEL TRENAUNAY SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (51)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anomalous pulmonary artery	Anomalous Pulmonary Artery	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32090983	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	29641288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital abnormality of vein	Venous malformation	BEFREE	23197652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28743963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	27513923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31858546, 32925786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32925786	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27865839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29375300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29375300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29375300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	27513923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28743963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops Fetalis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31092480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24462738	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31858546	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron-Refractory Iron Deficiency Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
	Klippel-Trenaunay-Weber Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Klippel-Trenaunay-Weber Syndrome	Klippel-Trenaunay-Weber Syndrome	BEFREE	14961121, 15905966, 16379592, 16443853, 18564129, 19556247, 23197652, 27522498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Klippel-Trenaunay-Weber Syndrome	Klippel-Trenaunay-Weber Syndrome	UNIPROT_DG	14961121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Klippel-Trenaunay-Weber Syndrome	Klippel-Trenaunay-Weber Syndrome	ORPHANET_DG	18564129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29340079, 30710550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32925786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28289272, 30858758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30858758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	27513923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27522498, 30858758		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29885663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	23110058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	25421114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27865839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28289272, 30858758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28289272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29885663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia Platelet Dysfunction Hemolysis and Imbalanced Globin Synthesis	Thrombocytopenia	Pubtator	25421114	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24462738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	16443853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	16443853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Malformations	Vascular malformation	Pubtator	19556247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous malformation	Venous malformation	BEFREE	23197652		★★★★★ ★☆☆☆☆ Found in Text Mining only

AGGF1 (angiogenic factor with G-patch and FHA domains 1)