Gene Gene information from NCBI Gene database.
Entrez ID 55106
Gene name Schlafen family member 12
Gene symbol SLFN12
Synonyms (NCBI Gene)
SLFN3
Chromosome 17
Chromosome location 17q12
miRNA miRNA information provided by mirtarbase database.
78
miRTarBase ID miRNA Experiments Reference
MIRT030301 hsa-miR-26b-5p Microarray 19088304
MIRT721675 hsa-miR-6782-5p HITS-CLIP 19536157
MIRT721674 hsa-miR-4723-5p HITS-CLIP 19536157
MIRT721673 hsa-miR-5698 HITS-CLIP 19536157
MIRT721672 hsa-miR-6870-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0004540 Function RNA nuclease activity IDA 34272366
GO:0004540 Function RNA nuclease activity IEA
GO:0004540 Function RNA nuclease activity IMP 35104454
GO:0005515 Function Protein binding IPI 31420216, 32814053, 34272366, 35104454
GO:0005634 Component Nucleus IDA 35104454
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614955 25500 ENSG00000172123
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IYM2
Protein name Ribonuclease SLFN12 (EC 3.1.-.-) (Schlafen family member 12)
Protein function Ribonuclease which is part of an E2/17beta-estradiol-induced pro-apoptotic signaling pathway. E2 stabilizes the PDE3A/SLFN12 complex in the cytosol, promoting the dephosphorylation of SLFN12 and activating its pro-apoptotic ribosomal RNA/rRNA ri
PDB 7EG0 , 7EG1 , 7EG4 , 7LRC , 7LRD , 7LRE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04326 AlbA_2 200 334 Putative DNA-binding domain Domain
Sequence
MNISVDLETNYAELVLDVGRVTLGENSRKKMKDCKLRKKQNESVSRAMCALLNSGGGVIK
AEIENEDYSYTKDGIGLDLENSFSNILLFVPEYLDFMQNGNYFLIFVKSWSLNTSGLRIT
TLSSNLYKRDITSAKVMNATAALEFLKDMKKTRGRLYLRPELLAKRPCVDIQEENNMKAL
AGVFFDRTELDRKEKLTFTESTHVEIKNFSTEKLLQRIKEILPQYVSAFANTDGGYLFIG
LNEDKEIIGFKAEMSDLDDLEREIEKSIRKMPVHHFCMEKKKINYSCKFLGVYDKGSLCG
YVCALRVERFCCAVFAKEPDSWHVKDNRVMQLTR
KEWIQFMVEAEPKFSSSYEEVISQIN
TSLPAPHSWPLLEWQRQRHHCPGLSGRITYTPENLCRKLFLQHEGLKQLICEEMDSVRKG
SLIFSRSWSVDLGLQENHKVLCDALLISQDSPPVLYTFHMVQDEEFKGYSTQTALTLKQK
LAKIGGYTKKVCVMTKIFYLSPEGMTSCQYDLRSQVIYPESYYFTRRKYLLKALFKALKR
LKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRLT
Sequence length 578
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BARRETT'S ESOPHAGUS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Atrophy Atrophy Pubtator 30045019 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 31838790 Inhibit
★☆☆☆☆
Found in Text Mining only
Colon Carcinoma Colon Carcinoma BEFREE 21596996
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 21596996 Associate
★☆☆☆☆
Found in Text Mining only
Gastrointestinal Stromal Tumors Gastrointestinal stromal tumor BEFREE 28454120
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 39740094 Associate
★☆☆☆☆
Found in Text Mining only
Hashimoto Disease Hashimoto disease Pubtator 38075038 Stimulate
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 21596996, 24768141, 31749907, 31838790
★☆☆☆☆
Found in Text Mining only
Malignant tumor of colon Colonic Neoplasms BEFREE 21596996
★☆☆☆☆
Found in Text Mining only
Multiple Sclerosis Multiple sclerosis Pubtator 30379917 Inhibit
★☆☆☆☆
Found in Text Mining only