Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	5510
Gene name	Protein phosphatase 1 regulatory subunit 7
Gene symbol	PPP1R7
Synonyms (NCBI Gene)	SDS22
Chromosome	2
Chromosome location	2q37.3
Summary	This gene encodes a protein subunit that regulates the activity of the serine/threonine phosphatase, protein phosphatase-1. The encoded protein is required for completion of the mitotic cycle and for targeting protein phosphatase-1 to mitotic kinetochores

Show/Hide all (64)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001605	hsa-let-7b-5p	pSILAC	18668040
MIRT001605	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT044691	hsa-miR-320a	CLASH	23622248
MIRT039247	hsa-miR-454-3p	CLASH	23622248
MIRT2075675	hsa-miR-148a	CLIP-seq
MIRT2075676	hsa-miR-148b	CLIP-seq
MIRT2075677	hsa-miR-152	CLIP-seq
MIRT2075678	hsa-miR-3647-3p	CLIP-seq
MIRT2075679	hsa-miR-3664-3p	CLIP-seq
MIRT2075680	hsa-miR-4433	CLIP-seq
MIRT2075681	hsa-miR-4459	CLIP-seq
MIRT2075682	hsa-miR-4697-3p	CLIP-seq
MIRT2075683	hsa-miR-4768-3p	CLIP-seq
MIRT2075684	hsa-miR-4783-5p	CLIP-seq
MIRT2075685	hsa-miR-515-3p	CLIP-seq
MIRT2075686	hsa-miR-519e	CLIP-seq
MIRT2075687	hsa-miR-522	CLIP-seq
MIRT2075688	hsa-miR-552	CLIP-seq
MIRT2302268	hsa-miR-1267	CLIP-seq
MIRT2302269	hsa-miR-1285	CLIP-seq
MIRT2302270	hsa-miR-134	CLIP-seq
MIRT2302271	hsa-miR-137	CLIP-seq
MIRT2075675	hsa-miR-148a	CLIP-seq
MIRT2075676	hsa-miR-148b	CLIP-seq
MIRT2302272	hsa-miR-151-5p	CLIP-seq
MIRT2302273	hsa-miR-151b	CLIP-seq
MIRT2075677	hsa-miR-152	CLIP-seq
MIRT2302274	hsa-miR-3118	CLIP-seq
MIRT2302275	hsa-miR-3126-5p	CLIP-seq
MIRT2302276	hsa-miR-3150b-3p	CLIP-seq
MIRT2302277	hsa-miR-3164	CLIP-seq
MIRT2302278	hsa-miR-3187-5p	CLIP-seq
MIRT2075679	hsa-miR-3664-3p	CLIP-seq
MIRT2302279	hsa-miR-3940-5p	CLIP-seq
MIRT2302280	hsa-miR-4277	CLIP-seq
MIRT2075680	hsa-miR-4433	CLIP-seq
MIRT2075681	hsa-miR-4459	CLIP-seq
MIRT2302281	hsa-miR-4507	CLIP-seq
MIRT2302282	hsa-miR-4659a-5p	CLIP-seq
MIRT2302283	hsa-miR-4659b-5p	CLIP-seq
MIRT2075682	hsa-miR-4697-3p	CLIP-seq
MIRT2075683	hsa-miR-4768-3p	CLIP-seq
MIRT2302284	hsa-miR-4776-3p	CLIP-seq
MIRT2302285	hsa-miR-4784	CLIP-seq
MIRT2075685	hsa-miR-515-3p	CLIP-seq
MIRT2075686	hsa-miR-519e	CLIP-seq
MIRT2075688	hsa-miR-552	CLIP-seq
MIRT2302286	hsa-miR-612	CLIP-seq
MIRT2302287	hsa-miR-629	CLIP-seq
MIRT2302288	hsa-miR-758	CLIP-seq
MIRT2302289	hsa-miR-943	CLIP-seq
MIRT2075679	hsa-miR-3664-3p	CLIP-seq
MIRT2075680	hsa-miR-4433	CLIP-seq
MIRT2075681	hsa-miR-4459	CLIP-seq
MIRT2075683	hsa-miR-4768-3p	CLIP-seq
MIRT2075688	hsa-miR-552	CLIP-seq
MIRT2598973	hsa-miR-302f	CLIP-seq
MIRT2598974	hsa-miR-31	CLIP-seq
MIRT2075678	hsa-miR-3647-3p	CLIP-seq
MIRT2598975	hsa-miR-3688-5p	CLIP-seq
MIRT2598976	hsa-miR-4302	CLIP-seq
MIRT2598977	hsa-miR-4766-5p	CLIP-seq
MIRT2598978	hsa-miR-644	CLIP-seq
MIRT2598979	hsa-miR-891a	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	23414517, 24366813, 25416956, 25593058, 26496610, 27173435, 27880917, 28330616, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7498485
GO:0005694	Component	Chromosome	IDA	22801782
GO:0005737	Component	Cytoplasm	TAS	7498485
GO:0019888	Function	Protein phosphatase regulator activity	IMP	22801782
GO:0019888	Function	Protein phosphatase regulator activity	TAS	7498485
GO:0030234	Function	Enzyme regulator activity	NAS	10231361
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
602877	9295	ENSG00000115685

Q15435

Protein name

Protein phosphatase 1 regulatory subunit 7 (Protein phosphatase 1 regulatory subunit 22)

Protein function

Regulatory subunit of protein phosphatase 1.

PDB

6HKW , 6MKY , 6OBN , 6OBP , 8B5R , 8U5G

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14580	LRR_9	120 → 215		Repeat
PF14580	LRR_9	256 → 360		Repeat

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:7498485}.

Sequence

MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE
EEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQ
SLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIE
NLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSN
RLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQE
FWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF

Sequence length

360

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	19072283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30500680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29183848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12776201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	19072283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29669786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia 16	Dystonia	Pubtator	36011278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29669786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36011278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30500680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30500680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20131318, 21399659, 30500680		★★★★★ ★☆☆☆☆ Found in Text Mining only

PPP1R7 (protein phosphatase 1 regulatory subunit 7)