Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55090
Gene name	Mediator complex subunit 9
Gene symbol	MED9
Synonyms (NCBI Gene)	MED25
Chromosome	17
Chromosome location	17p11.2
Summary	The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located wit

109

Show/Hide all (109)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029693	hsa-miR-26b-5p	Microarray	19088304
MIRT440257	ebv-miR-BART13-3p	HITS-CLIP	22473208
MIRT440258	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT440257	ebv-miR-BART13-3p	HITS-CLIP	22473208
MIRT440258	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT1141965	hsa-miR-1207-5p	CLIP-seq
MIRT1141966	hsa-miR-1225-3p	CLIP-seq
MIRT1141967	hsa-miR-1233	CLIP-seq
MIRT1141968	hsa-miR-1237	CLIP-seq
MIRT1141969	hsa-miR-129-3p	CLIP-seq
MIRT1141970	hsa-miR-1470	CLIP-seq
MIRT1141971	hsa-miR-151-5p	CLIP-seq
MIRT1141972	hsa-miR-151b	CLIP-seq
MIRT1141973	hsa-miR-15a	CLIP-seq
MIRT1141974	hsa-miR-15b	CLIP-seq
MIRT1141975	hsa-miR-16	CLIP-seq
MIRT1141976	hsa-miR-1827	CLIP-seq
MIRT1141977	hsa-miR-18a	CLIP-seq
MIRT1141978	hsa-miR-18b	CLIP-seq
MIRT1141979	hsa-miR-1915	CLIP-seq
MIRT1141980	hsa-miR-193a-3p	CLIP-seq
MIRT1141981	hsa-miR-193b	CLIP-seq
MIRT1141982	hsa-miR-195	CLIP-seq
MIRT1141983	hsa-miR-296-3p	CLIP-seq
MIRT1141984	hsa-miR-3144-5p	CLIP-seq
MIRT1141985	hsa-miR-3150b-3p	CLIP-seq
MIRT1141986	hsa-miR-3152-5p	CLIP-seq
MIRT1141987	hsa-miR-3157-5p	CLIP-seq
MIRT1141988	hsa-miR-3160-3p	CLIP-seq
MIRT1141989	hsa-miR-3183	CLIP-seq
MIRT1141990	hsa-miR-3202	CLIP-seq
MIRT1141991	hsa-miR-335	CLIP-seq
MIRT1141992	hsa-miR-3545-3p	CLIP-seq
MIRT1141993	hsa-miR-3612	CLIP-seq
MIRT1141994	hsa-miR-361-3p	CLIP-seq
MIRT1141995	hsa-miR-3622a-3p	CLIP-seq
MIRT1141996	hsa-miR-3622b-3p	CLIP-seq
MIRT1141997	hsa-miR-3667-5p	CLIP-seq
MIRT1141998	hsa-miR-424	CLIP-seq
MIRT1141999	hsa-miR-4254	CLIP-seq
MIRT1142000	hsa-miR-4266	CLIP-seq
MIRT1142001	hsa-miR-4325	CLIP-seq
MIRT1142002	hsa-miR-4423-5p	CLIP-seq
MIRT1142003	hsa-miR-4457	CLIP-seq
MIRT1142004	hsa-miR-4469	CLIP-seq
MIRT1142005	hsa-miR-4476	CLIP-seq
MIRT1142006	hsa-miR-4493	CLIP-seq
MIRT1142007	hsa-miR-451b	CLIP-seq
MIRT1142008	hsa-miR-4539	CLIP-seq
MIRT737764	hsa-miR-4667-3p	CLIP-seq
MIRT1142009	hsa-miR-4689	CLIP-seq
MIRT1142010	hsa-miR-4695-5p	CLIP-seq
MIRT1142011	hsa-miR-4723-3p	CLIP-seq
MIRT1142012	hsa-miR-4724-5p	CLIP-seq
MIRT1142013	hsa-miR-4731-3p	CLIP-seq
MIRT1142014	hsa-miR-4735-3p	CLIP-seq
MIRT1142015	hsa-miR-4761-5p	CLIP-seq
MIRT1142016	hsa-miR-4763-3p	CLIP-seq
MIRT1142017	hsa-miR-4779	CLIP-seq
MIRT1142018	hsa-miR-4784	CLIP-seq
MIRT1142019	hsa-miR-4801	CLIP-seq
MIRT1142020	hsa-miR-490-3p	CLIP-seq
MIRT1142021	hsa-miR-497	CLIP-seq
MIRT1142022	hsa-miR-544	CLIP-seq
MIRT1142023	hsa-miR-619	CLIP-seq
MIRT1142024	hsa-miR-624	CLIP-seq
MIRT1142025	hsa-miR-650	CLIP-seq
MIRT1142026	hsa-miR-940	CLIP-seq
MIRT1142027	hsa-miR-944	CLIP-seq
MIRT2040311	hsa-miR-1206	CLIP-seq
MIRT2040312	hsa-miR-1248	CLIP-seq
MIRT2040313	hsa-miR-2110	CLIP-seq
MIRT2040314	hsa-miR-2467-5p	CLIP-seq
MIRT2040315	hsa-miR-3188	CLIP-seq
MIRT2040316	hsa-miR-3614-3p	CLIP-seq
MIRT2040317	hsa-miR-3658	CLIP-seq
MIRT2040318	hsa-miR-3975	CLIP-seq
MIRT2040319	hsa-miR-4271	CLIP-seq
MIRT2040320	hsa-miR-4652-3p	CLIP-seq
MIRT737764	hsa-miR-4667-3p	CLIP-seq
MIRT2040321	hsa-miR-4687-3p	CLIP-seq
MIRT2040322	hsa-miR-4725-3p	CLIP-seq
MIRT2040323	hsa-miR-485-5p	CLIP-seq
MIRT1142026	hsa-miR-940	CLIP-seq
MIRT2270121	hsa-miR-203	CLIP-seq
MIRT2270122	hsa-miR-3154	CLIP-seq
MIRT2270123	hsa-miR-3179	CLIP-seq
MIRT2270124	hsa-miR-4716-3p	CLIP-seq
MIRT2270125	hsa-miR-4766-5p	CLIP-seq
MIRT2270126	hsa-miR-508-5p	CLIP-seq
MIRT2270127	hsa-miR-625	CLIP-seq
MIRT2270128	hsa-miR-665	CLIP-seq
MIRT1142027	hsa-miR-944	CLIP-seq
MIRT737763	hsa-miR-1976	CLIP-seq
MIRT2569181	hsa-miR-3194-3p	CLIP-seq
MIRT2569182	hsa-miR-3618	CLIP-seq
MIRT737764	hsa-miR-4667-3p	CLIP-seq
MIRT2569183	hsa-miR-4704-5p	CLIP-seq
MIRT737762	hsa-miR-4722-3p	CLIP-seq
MIRT2569184	hsa-miR-548ac	CLIP-seq
MIRT2569185	hsa-miR-548ae	CLIP-seq
MIRT2569186	hsa-miR-548aj	CLIP-seq
MIRT2569187	hsa-miR-548am	CLIP-seq
MIRT2569188	hsa-miR-548d-3p	CLIP-seq
MIRT2569189	hsa-miR-548v	CLIP-seq
MIRT2569190	hsa-miR-548x	CLIP-seq
MIRT2569191	hsa-miR-548z	CLIP-seq
MIRT2569192	hsa-miR-552	CLIP-seq
MIRT2569193	hsa-miR-671-5p	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0005515	Function	Protein binding	IPI	14638676, 15175163, 24882805, 24981860, 25281560, 28514442, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	24882805
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0016592	Component	Mediator complex	IBA
GO:0016592	Component	Mediator complex	IEA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	NAS	11559591
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	NAS	11559591
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	NAS	11559591
GO:0070847	Component	Core mediator complex	IPI	24882805

MIM	HGNC	e!Ensembl
609878	25487	ENSG00000141026

Q9NWA0

Protein name

Mediator of RNA polymerase II transcription subunit 9 (Mediator complex subunit 9)

Protein function

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RN

PDB

7EMF , 7ENA , 7ENC , 7ENJ , 7LBM , 7NVR , 8GXQ , 8GXS , 8T9D , 8TQW , 8TRH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07544	Med9	64 → 139	RNA polymerase II transcription mediator complex subunit 9	Family

Sequence

MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPPQPPPVPAPQPQQSPAPRPQSPARAREE
ENYSFLPLVHNIIKCMDKDSPEVHQDLNALKSKFQEMRKLISTMPGIHLSPEQQQQQLQS
LREQVRTKNELLQKYKSLCMFEIPKE

Sequence length

146

Interactions

View interactions

	Reactome
			PPARA activates gene expression Transcriptional regulation of white adipocyte differentiation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Heart Defects Congenital	Congenital heart defect	Pubtator	25205790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	19177570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28728983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28728983		★★★★★ ★☆☆☆☆ Found in Text Mining only

MED9 (mediator complex subunit 9)