KIF26B (kinesin family member 26B)

Gene

• Entrez ID: 55083
• Gene name: Kinesin family member 26B
• Gene symbol: KIF26B
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q44
• Summary: The protein encoded by this gene is an intracellular motor protein thought to transport organelles along microtubules. The encoded protein is required for kidney development. Elevated levels of this protein have been found in some breast and colorectal ca

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT667705	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT656874	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT656873	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT656872	hsa-miR-3944-3p	HITS-CLIP	23824327
MIRT667704	hsa-miR-4279	HITS-CLIP	23824327
MIRT656871	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT656874	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT656873	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT656872	hsa-miR-3944-3p	HITS-CLIP	23824327
MIRT656871	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT536468	hsa-miR-634	PAR-CLIP	22012620
MIRT536467	hsa-miR-4690-3p	PAR-CLIP	22012620
MIRT536466	hsa-miR-5685	PAR-CLIP	22012620
MIRT536464	hsa-miR-4530	PAR-CLIP	22012620
MIRT732249	hsa-miR-20a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27499703
MIRT732249	hsa-miR-20a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27499703
MIRT667705	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT656874	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT656873	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT656872	hsa-miR-3944-3p	HITS-CLIP	23824327
MIRT667704	hsa-miR-4279	HITS-CLIP	23824327
MIRT656871	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT656874	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT656873	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT656872	hsa-miR-3944-3p	HITS-CLIP	23824327
MIRT656871	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT536468	hsa-miR-634	PAR-CLIP	22012620
MIRT536467	hsa-miR-4690-3p	PAR-CLIP	22012620
MIRT536466	hsa-miR-5685	PAR-CLIP	22012620
MIRT536464	hsa-miR-4530	PAR-CLIP	22012620
MIRT1094412	hsa-miR-1253	CLIP-seq
MIRT1094413	hsa-miR-29a	CLIP-seq
MIRT1094414	hsa-miR-29b	CLIP-seq
MIRT1094415	hsa-miR-29c	CLIP-seq
MIRT1094416	hsa-miR-3158-3p	CLIP-seq
MIRT1094417	hsa-miR-451b	CLIP-seq
MIRT1094418	hsa-miR-4520a-3p	CLIP-seq
MIRT1094419	hsa-miR-4520b-3p	CLIP-seq
MIRT2025295	hsa-miR-3064-3p	CLIP-seq
MIRT2025296	hsa-miR-4715-3p	CLIP-seq
MIRT2025297	hsa-miR-499a-5p	CLIP-seq
MIRT2256568	hsa-miR-124	CLIP-seq
MIRT2256569	hsa-miR-2116	CLIP-seq
MIRT1094416	hsa-miR-3158-3p	CLIP-seq
MIRT2256570	hsa-miR-342-3p	CLIP-seq
MIRT2256571	hsa-miR-3924	CLIP-seq
MIRT2256572	hsa-miR-4274	CLIP-seq
MIRT2256573	hsa-miR-4277	CLIP-seq
MIRT2256574	hsa-miR-450b-5p	CLIP-seq
MIRT2256575	hsa-miR-4519	CLIP-seq
MIRT2256576	hsa-miR-4708-3p	CLIP-seq
MIRT2256577	hsa-miR-506	CLIP-seq
MIRT2256578	hsa-miR-513a-5p	CLIP-seq
MIRT2256579	hsa-miR-621	CLIP-seq
MIRT2256580	hsa-miR-622	CLIP-seq
MIRT1094413	hsa-miR-29a	CLIP-seq
MIRT1094414	hsa-miR-29b	CLIP-seq
MIRT1094415	hsa-miR-29c	CLIP-seq
MIRT2025295	hsa-miR-3064-3p	CLIP-seq
MIRT2025296	hsa-miR-4715-3p	CLIP-seq
MIRT2430433	hsa-miR-4731-3p	CLIP-seq
MIRT2430434	hsa-miR-4801	CLIP-seq
MIRT2025297	hsa-miR-499a-5p	CLIP-seq
MIRT2430435	hsa-miR-548l	CLIP-seq
MIRT2430436	hsa-miR-767-5p	CLIP-seq
MIRT1094413	hsa-miR-29a	CLIP-seq
MIRT1094414	hsa-miR-29b	CLIP-seq
MIRT1094415	hsa-miR-29c	CLIP-seq
MIRT2430433	hsa-miR-4731-3p	CLIP-seq
MIRT2430434	hsa-miR-4801	CLIP-seq
MIRT2430435	hsa-miR-548l	CLIP-seq
MIRT2430436	hsa-miR-767-5p	CLIP-seq
MIRT1094413	hsa-miR-29a	CLIP-seq
MIRT1094414	hsa-miR-29b	CLIP-seq
MIRT1094415	hsa-miR-29c	CLIP-seq
MIRT2430433	hsa-miR-4731-3p	CLIP-seq
MIRT2430434	hsa-miR-4801	CLIP-seq
MIRT2430435	hsa-miR-548l	CLIP-seq
MIRT2430436	hsa-miR-767-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0008017	Function	Microtubule binding	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IEA
GO:0030010	Process	Establishment of cell polarity	IEA
GO:0048731	Process	System development	IEA
GO:0072092	Process	Ureteric bud invasion	IEA

Other IDs

• MIM: 614026
• HGNC: 25484
• e!Ensembl: ENSG00000162849

Protein

• UniProt ID: Q2KJY2
• Protein name: Kinesin-like protein KIF26B
• Protein function: Essential for embryonic kidney development. Plays an important role in the compact adhesion between mesenchymal cells adjacent to the ureteric buds, possibly by interacting with MYH10. This could lead to the establishment of the basolateral inte
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00225	Kinesin	472 → 801	Kinesin motor domain	Domain

• Sequence:

  MNSVAGNKERLAVSTRGKKYGVNEVCSPTKPAAPFSPESWYRKAYEESRAGSRPTPEGAG
  SALGSSGTPSPGSGTSSPSSFTGSPGPASPGIGTSSPGSLGGSPGFGTGSPGSGSGGGSS
  PGSDRGVWCENCNARLVELKRQALRLLLPGPFPGKDPAFSAVIHDKLQVPNTIRKAWNDR
  DNRCDICATHLNQLKQEAIQMVLTLEQAAGSEHYDASPCSPPPLSNIPTLVGSRHVGGLQ
  QPRDWAFVPAPCATSNYTGFANKHGSKPSSLGVSNGAEKKSGSPTHQAKVSLQMATSPSN
  GNILNSVAIQAHQYLDGTWSLSRTNGVTLYPYQISQLMTESSREGLTEAVLNRYNADKPS
  ACSVPASQGSCVASETSTGTSVAASFFARAAQKLNLSSKKKKHRPSTSSAAEPPLFATSF
  SGILQTSPPPAPPCLLRAVNKVKDTPGLGKVKVMLRICSTLARDTSESSSFLKVDPRKKQ
  ITLYDPLTCGGQNAFQKRGNQVPPKMFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADG
  CVFCFGHAKLGKSYTMIGKDDSMQNLGIIPCAISWLFKLINERKEKTGARFSVRVSAVEV
  WGKEENLRDLLSEVATGSLQDGQSPGVYLCEDPICGTQLQNQSELRAPTAEKAAFFLDAA
  IASRRSHQQDCDEDDHRNSHVFFTLHIYQYRMEKSGKGGMSGGRSRLHLIDLGSCVKALS
  KNREGGSGLCLSLSALGNVILALVNGSKHIPYKESKLAMLLRESLGNMNCRTTMIAHISA
  AVGSYAETLSTIQIASRVLRMKKKKTKYTSSSSGGESSCEEGRMRRPTQLRPFHTRATVD
  PDFPIAHLSSDPDYSSSSEQSCDTVIYIGPNGTALSDKELTDNEGPPDFVPIVPALQKTR
  GDSRPAEAGEAAAGKSERDCLKCNTFAELQERLDCIDGSEEPSSFPFEELPAQFGPEQAS
  RGPRLSQAAGASPLSESDKEDNGSEGQLTNREGPELPASKMQRSHSPVPAAAPAHSPSPA
  SPRSVPGSSSQHSASPLVQSPSLQSSRESLNSCGFVEGKPRPMGSPRLGIASLSKTSEYK
  PPSSPSQRCKVYTQKGVLPSPAPLPPSSKDSGVASRESLLQPEVRTPPVGMSPQVLKKSM
  SAGSEGFPETPVDDEQQAATPSESKKEILSTTMVTVQQPLELNGEDELVFTLVEELTISG
  VLDSGRPTSIISFNSDCSARALASGSRPVSIISSISEDLECYSSTAPVSEVSITQFLPLP
  KMSLDEKAQDAGSRRSSISSWLSEMSAGSEGEQSCHSFIAQTCFGHGEAMAEPVASEFVS
  SLQNTAVVCREKPKASPDNLLILSEMGDDSFNKAAPIKGCKISTVSKAMVTISNTANLSS
  CEGYIPMKTNITVYPCIAMSPRNIQEPEAPTATPKAGPTLAQSRESKENSAKKEMKFEDP
  WLKREEEVKKETAHPNEEGMMRCETATGPSNAETRAEQEQDGKPSPGDRLSSSSGEVSAS
  PVTDNFRRVVDGCEMALPGLATQSPVHPNKSVKSSSLPRAFQKASRQEEPDSLSYYCAAE
  TNGVGAASGTPPSKATLEGKVASPKHCVLARPKGTPPLPPVRKSSLDQKNRASPQHSASG
  SGTSSPLNQPAAFPAGLPDEPSGKTKDASSSSKLFSAKLEQLASRSNSLGRATVSHYECL
  SLERAESLSSVSSRLHAGKDGTMPRAGRSLGRSAGTSPPSSGASPKAGQSKISAVSRLLL
  ASPRARGPSASTTKTLSFSTKSLPQAVGQGSSSPPGGKHTPWSTQSLSRNRSSGLASKLP
  LRAVSGRISELLQGGAGARGLQLRAGPEAEARGGALAEDEPAAAHLLPSPYSKITPPRRP
  HRCSSGHGSDNSSVLSGELPPAMGKTALFYHSGGSSGYESVMRDSEATGSASSAQDSTSE
  NSSSVGGRCRSLKTPKKRSNPGSQRRRLIPALSLDTSSPVRKPPNSTGVRWVDGPLRSSP
  RGLGEPFEIKVYEIDDVERLQRRRGGASKEAMCFNAKLKILEHRQQRIAEVRAKYEWLMK
  ELEATKQYLMLDPNKWLSEFDLEQVWELDSLEYLEALECVTERLESRVNFCKAHLMMITC
  FDITSRRR

• Sequence length: 2108

Pathways

KEGG:

Motor proteins

Reactome:

COPI-dependent Golgi-to-ER retrograde traffic
Kinesins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal dominant cerebellar ataxia	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CENTRAL NERVOUS SYSTEM INFECTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIF26B-related disorder	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRICUSPID VALVE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIGEMINAL NERVE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	32799327	Associate	★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	BEFREE	30151950		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23585914, 29881293, 30248545		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23585914	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37551622	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23585914, 25652119	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29880787		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	GWASDB_DG	19578366		★☆☆☆☆ Found in Text Mining only
Coloboma of optic disc	Coloboma of optic disc	CLINVAR_DG	26571382		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37436127	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25652119		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25652119	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27935967, 37436127	Associate	★☆☆☆☆ Found in Text Mining only
Congenital pontocerebellar hypoplasia	Pontoneocerebellar hypoplasia	BEFREE	30151950		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASCAT_DG	30664745		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	GWASCAT_DG	30177863		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	GWASDB_DG	19578366		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	GWASCAT_DG	30251476		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GWASCAT_DG	26718567		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	31077021		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34579730	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31388332		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23585914, 29881293, 30248545		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29880787		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28581513		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27935967		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	35866054	Stimulate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	28328126		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23585914, 25652119, 28581513, 29881293, 30248545		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30342167		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	29880787		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29880787	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32186777	Associate	★☆☆☆☆ Found in Text Mining only
Papillorenal syndrome	Renal Coloboma Syndrome	BEFREE	26571382		★☆☆☆☆ Found in Text Mining only
Papillorenal syndrome	Papillorenal syndrome	Pubtator	26571382	Associate	★☆☆☆☆ Found in Text Mining only
Pontocerebellar Hypoplasia Type 1	Pontoneocerebellar hypoplasia	BEFREE	30151950		★☆☆☆☆ Found in Text Mining only
Pontoneocerebellar hypoplasia	Pontoneocerebellar hypoplasia	BEFREE	30151950		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	30251476		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28581513		★☆☆☆☆ Found in Text Mining only