Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55079
Gene name	FEZ family zinc finger 2
Gene symbol	FEZF2
Synonyms (NCBI Gene)	FEZFEZLFKSG36TOFZFP312ZNF312
Chromosome	3
Chromosome location	3p14.2

Show/Hide all (21)

miRTarBase ID	miRNA	Experiments
MIRT995053	hsa-miR-3180	CLIP-seq
MIRT995054	hsa-miR-3180-3p	CLIP-seq
MIRT995055	hsa-miR-3196	CLIP-seq
MIRT995056	hsa-miR-4438	CLIP-seq
MIRT995057	hsa-miR-4505	CLIP-seq
MIRT995058	hsa-miR-4731-5p	CLIP-seq
MIRT995059	hsa-miR-542-3p	CLIP-seq
MIRT2229127	hsa-miR-1252	CLIP-seq
MIRT2229128	hsa-miR-1321	CLIP-seq
MIRT2229129	hsa-miR-3202	CLIP-seq
MIRT2229130	hsa-miR-4270	CLIP-seq
MIRT2229131	hsa-miR-4441	CLIP-seq
MIRT2229132	hsa-miR-4459	CLIP-seq
MIRT2229133	hsa-miR-4476	CLIP-seq
MIRT2229134	hsa-miR-4533	CLIP-seq
MIRT2229135	hsa-miR-4700-3p	CLIP-seq
MIRT2229136	hsa-miR-4728-5p	CLIP-seq
MIRT2229137	hsa-miR-4739	CLIP-seq
MIRT2229138	hsa-miR-4747-5p	CLIP-seq
MIRT2229139	hsa-miR-4756-5p	CLIP-seq
MIRT2229140	hsa-miR-4790-5p	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007413	Process	Axonal fasciculation	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0016358	Process	Dendrite development	IEA
GO:0021537	Process	Telencephalon development	IEA
GO:0021542	Process	Dentate gyrus development	IEA
GO:0021797	Process	Forebrain anterior/posterior pattern specification	IEA
GO:0021853	Process	Cerebral cortex GABAergic interneuron migration	IEA
GO:0021895	Process	Cerebral cortex neuron differentiation	IEA
GO:0021902	Process	Commitment of neuronal cell to specific neuron type in forebrain	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043697	Process	Cell dedifferentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048664	Process	Neuron fate determination	IEA
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0097154	Process	GABAergic neuron differentiation	IEA
GO:1902667	Process	Regulation of axon guidance	IEA

MIM	HGNC	e!Ensembl
607414	13506	ENSG00000153266

Q8TBJ5

Protein name

Fez family zinc finger protein 2 (Forebrain embryonic zinc finger-like protein 2) (Zinc finger protein 312) (Zinc finger protein Fez-like)

Protein function

Transcription repressor. Required for the specification of corticospinal motor neurons and other subcerebral projection neurons. May play a role in layer and neuronal subtype-specific patterning of subcortical projections and axonal fasciculatio

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	277 → 299	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	305 → 327	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	333 → 355	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	361 → 383	Zinc finger, C2H2 type	Domain
PF13912	zf-C2H2_6	388 → 414		Domain
PF00096	zf-C2H2	417 → 440	Zinc finger, C2H2 type	Domain

Sequence

MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRPGALEADGSQG
KKLLNLCSPLPCMIPLQPLGYEVPSKTLLSYSELWKSSLRAGGGGGGGGGGGGGGGGAPV
CGASGLCKTNCGVCCKAELGLAPSALPAGRVIKPQVINQAVGLPASGSLYYFNYLDSTAY
PPSELLSGHLFPSGLLNAQAPAALAAHPKLFLLENAKLAGLAADKFPHPAPYPHKERLPA
PLEQVLKENSALTAERGGVKGHSKLPGGSADGKPKNFTCEVCGKVFNAHYNLTRHMPVHT
GARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKP
FVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCA
TCGKGFCRNFDLKKHVRKLHDSVGPAAPSAKDLTRTVQS

Sequence length

459

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEZF2-related disorder	Likely benign; Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10662802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	24290386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29291257, 31008523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29925938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29925938		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	25193415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	39615603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31276636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24762493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31006040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31006040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	39615603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29925938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	21471212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23677067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23677067, 29925938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15541816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	15383419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	23403794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29925938	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

FEZF2 (FEZ family zinc finger 2)