Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55070
Gene name	DET1 partner of COP1 E3 ubiquitin ligase
Gene symbol	DET1
Synonyms (NCBI Gene)	-
Chromosome	15
Chromosome location	15q26.1

106

Show/Hide all (106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000972	hsa-miR-155-5p	Luciferase reporter assay	18367535
MIRT000972	hsa-miR-155-5p	Luciferase reporter assay	18367535
MIRT000972	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT000972	hsa-miR-155-5p	ChIP-seqWestern blot	26497687
MIRT000972	hsa-miR-155-5p	ChIP-seqLuciferase reporter assayWestern blot	26497687
MIRT933277	hsa-let-7a	CLIP-seq
MIRT933278	hsa-let-7b	CLIP-seq
MIRT933279	hsa-let-7c	CLIP-seq
MIRT933280	hsa-let-7d	CLIP-seq
MIRT933281	hsa-let-7e	CLIP-seq
MIRT933282	hsa-let-7f	CLIP-seq
MIRT933283	hsa-let-7g	CLIP-seq
MIRT933284	hsa-let-7i	CLIP-seq
MIRT933285	hsa-miR-1244	CLIP-seq
MIRT933286	hsa-miR-1245b-3p	CLIP-seq
MIRT933287	hsa-miR-1289	CLIP-seq
MIRT933288	hsa-miR-149	CLIP-seq
MIRT933289	hsa-miR-150	CLIP-seq
MIRT933290	hsa-miR-202	CLIP-seq
MIRT933291	hsa-miR-297	CLIP-seq
MIRT933292	hsa-miR-3064-5p	CLIP-seq
MIRT933293	hsa-miR-30a	CLIP-seq
MIRT933294	hsa-miR-30b	CLIP-seq
MIRT933295	hsa-miR-30c	CLIP-seq
MIRT933296	hsa-miR-30d	CLIP-seq
MIRT933297	hsa-miR-30e	CLIP-seq
MIRT933298	hsa-miR-3140-3p	CLIP-seq
MIRT933299	hsa-miR-3160-5p	CLIP-seq
MIRT933300	hsa-miR-3171	CLIP-seq
MIRT933301	hsa-miR-3183	CLIP-seq
MIRT933302	hsa-miR-3185	CLIP-seq
MIRT933303	hsa-miR-3198	CLIP-seq
MIRT933304	hsa-miR-3200-5p	CLIP-seq
MIRT933305	hsa-miR-325	CLIP-seq
MIRT933306	hsa-miR-326	CLIP-seq
MIRT933307	hsa-miR-330-5p	CLIP-seq
MIRT933308	hsa-miR-365	CLIP-seq
MIRT933309	hsa-miR-3652	CLIP-seq
MIRT933310	hsa-miR-3942-3p	CLIP-seq
MIRT933311	hsa-miR-4294	CLIP-seq
MIRT933312	hsa-miR-4300	CLIP-seq
MIRT933313	hsa-miR-4309	CLIP-seq
MIRT933314	hsa-miR-4430	CLIP-seq
MIRT933315	hsa-miR-4458	CLIP-seq
MIRT933316	hsa-miR-4500	CLIP-seq
MIRT933317	hsa-miR-4649-3p	CLIP-seq
MIRT933318	hsa-miR-4671-5p	CLIP-seq
MIRT933319	hsa-miR-4690-5p	CLIP-seq
MIRT933320	hsa-miR-4713-5p	CLIP-seq
MIRT933321	hsa-miR-4723-3p	CLIP-seq
MIRT933322	hsa-miR-4794	CLIP-seq
MIRT933323	hsa-miR-483-3p	CLIP-seq
MIRT933324	hsa-miR-532-3p	CLIP-seq
MIRT933325	hsa-miR-567	CLIP-seq
MIRT933326	hsa-miR-616	CLIP-seq
MIRT933327	hsa-miR-760	CLIP-seq
MIRT933328	hsa-miR-920	CLIP-seq
MIRT933329	hsa-miR-98	CLIP-seq
MIRT933330	hsa-miR-1265	CLIP-seq
MIRT933331	hsa-miR-199a-3p	CLIP-seq
MIRT933332	hsa-miR-199b-3p	CLIP-seq
MIRT933291	hsa-miR-297	CLIP-seq
MIRT933333	hsa-miR-300	CLIP-seq
MIRT933293	hsa-miR-30a	CLIP-seq
MIRT933294	hsa-miR-30b	CLIP-seq
MIRT933295	hsa-miR-30c	CLIP-seq
MIRT933296	hsa-miR-30d	CLIP-seq
MIRT933297	hsa-miR-30e	CLIP-seq
MIRT933334	hsa-miR-3129-5p	CLIP-seq
MIRT933300	hsa-miR-3171	CLIP-seq
MIRT933335	hsa-miR-3688-3p	CLIP-seq
MIRT933336	hsa-miR-381	CLIP-seq
MIRT933337	hsa-miR-3978	CLIP-seq
MIRT933338	hsa-miR-4274	CLIP-seq
MIRT933339	hsa-miR-4519	CLIP-seq
MIRT933340	hsa-miR-4666-3p	CLIP-seq
MIRT933325	hsa-miR-567	CLIP-seq
MIRT933341	hsa-miR-568	CLIP-seq
MIRT933326	hsa-miR-616	CLIP-seq
MIRT933342	hsa-miR-656	CLIP-seq
MIRT933343	hsa-miR-936	CLIP-seq
MIRT1921988	hsa-miR-105	CLIP-seq
MIRT1921989	hsa-miR-27a	CLIP-seq
MIRT1921990	hsa-miR-27b	CLIP-seq
MIRT1921991	hsa-miR-3120-3p	CLIP-seq
MIRT1921992	hsa-miR-513a-5p	CLIP-seq
MIRT1921993	hsa-miR-518a-5p	CLIP-seq
MIRT1921994	hsa-miR-527	CLIP-seq
MIRT933286	hsa-miR-1245b-3p	CLIP-seq
MIRT933299	hsa-miR-3160-5p	CLIP-seq
MIRT933310	hsa-miR-3942-3p	CLIP-seq
MIRT933323	hsa-miR-483-3p	CLIP-seq
MIRT1976277	hsa-miR-548c-3p	CLIP-seq
MIRT933285	hsa-miR-1244	CLIP-seq
MIRT933305	hsa-miR-325	CLIP-seq
MIRT1921988	hsa-miR-105	CLIP-seq
MIRT2679210	hsa-miR-155	CLIP-seq
MIRT1921989	hsa-miR-27a	CLIP-seq
MIRT1921990	hsa-miR-27b	CLIP-seq
MIRT1921991	hsa-miR-3120-3p	CLIP-seq
MIRT933299	hsa-miR-3160-5p	CLIP-seq
MIRT2679211	hsa-miR-3179	CLIP-seq
MIRT2679212	hsa-miR-412	CLIP-seq
MIRT1921992	hsa-miR-513a-5p	CLIP-seq
MIRT2679213	hsa-miR-548n	CLIP-seq
MIRT2679214	hsa-miR-548t	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	14739464, 16949367
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IPI	14739464
GO:0031461	Component	Cullin-RING ubiquitin ligase complex	IBA
GO:0031464	Component	Cul4A-RING E3 ubiquitin ligase complex	IDA	14739464
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IMP	14739464
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IPI	14739464
GO:0044877	Function	Protein-containing complex binding	IDA	14739464
GO:0065003	Process	Protein-containing complex assembly	IDA	14739464
GO:0080008	Component	Cul4-RING E3 ubiquitin ligase complex	IDA	16949367
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IBA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IPI	14739464

MIM	HGNC	e!Ensembl
608727	25477	ENSG00000140543

Q7L5Y6

Protein name

DET1 homolog (De-etiolated-1 homolog)

Protein function

Component of the E3 ubiquitin ligase DCX DET1-COP1 complex, which is required for ubiquitination and subsequent degradation of target proteins. The complex is involved in JUN ubiquitination and degradation.

PDB

9DHD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09737	Det1	142 → 547	De-etiolated protein 1 Det1	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the ovary, some lymphoid organs and resting leukocytes. {ECO:0000269|PubMed:14739464}.

Sequence

MDHHVSTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQNVFPNFTVVNVEKPPC
FLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRL
FERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLPDEPHPPFFEVYRNSESV
TPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTIH
VFQVTPEGTFIDVRTIGRFCYEDDLLTVSAVFPEVQRDSQTGMANPFRDPFINSLKHRLL
VYLWRRAEQDGSAMAKRRFFQYFDQLRQLRMWKMQLLDENHLFIKYTSEDVVTLRVTDPS
QASFFVVYNMVTTEVIAVFENTSDELLELFENFCDLFRNATLHSEVQFPCSASSNNFARQ
IQRRFKDTIINAKYGGHTEAVRRLLGQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPK
TCGDHPIRFYARDSGLLKFEIQAGLLGRPINHTVRRLVAFTFHPFEPFAISVQRTNAEYV
VNFHMRHCCT

Sequence length

550

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis		Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Myocardial Infarction	Myocardial infarction	Pubtator	31698570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29360641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36194576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DET1 (DET1 partner of COP1 E3 ubiquitin ligase)