Gene Gene information from NCBI Gene database.
Entrez ID 550643
Gene name Negative regulator of P-body association
Gene symbol NBDY
Synonyms (NCBI Gene)
LINC01420NoBody
Chromosome X
Chromosome location Xp11.21
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
GO ID Ontology Definition Evidence Reference
GO:0000932 Component P-body IDA 27918561
GO:0000932 Component P-body IEA
GO:0000956 Process Nuclear-transcribed mRNA catabolic process IDA 27918561
GO:0005515 Function Protein binding IPI 27918561
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300992 50713 ENSG00000204272
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A0U1RRE5
Protein name Negative regulator of P-body association (P-body dissociating protein) (Protein NoBody)
Protein function Promotes dispersal of P-body components and is likely to play a role in the mRNA decapping process.
Family and domains
Sequence
MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLK
SHPPPPEK
Sequence length 68
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
HYPOGONADISM GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Lupus Erythematosus Systemic Systemic lupus erythematosus Pubtator 26635088, 31707854 Associate
★☆☆☆☆
Found in Text Mining only
Lupus Erythematosus, Systemic Lupus Erythematosus BEFREE 26635088
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of pancreas Pancreatic cancer BEFREE 31562613
★☆☆☆☆
Found in Text Mining only
Melanoma Melanoma Pubtator 32039714 Inhibit
★☆☆☆☆
Found in Text Mining only
Nasopharyngeal carcinoma Nasopharyngeal Carcinoma BEFREE 28123602
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 31562613
★☆☆☆☆
Found in Text Mining only
Pancreatic carcinoma Pancreatic carcinoma BEFREE 31562613
★☆☆☆☆
Found in Text Mining only