Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55054
Gene name	Autophagy related 16 like 1
Gene symbol	ATG16L1
Synonyms (NCBI Gene)	APG16LATG16AATG16LIBD10WDR30
Chromosome	2
Chromosome location	2q37.1
Summary	The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to infla

533

Show/Hide all (533)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049399	hsa-miR-92a-3p	CLASH	23622248
MIRT048211	hsa-miR-196a-5p	CLASH	23622248
MIRT038607	hsa-miR-188-3p	CLASH	23622248
MIRT053623	hsa-miR-106b-5p	HeLa	24036151
MIRT053623	hsa-miR-106b-5p	HeLa	24036151
MIRT053624	hsa-miR-93-5p	HeLa	24036151
MIRT053624	hsa-miR-93-5p	HeLa	24036151
MIRT053623	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT157856	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT087604	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT053623	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT157856	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT087601	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT087610	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT053624	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT087614	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT087602	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT087603	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT087604	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT087604	hsa-miR-20a-5p	ImmunofluorescenceImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	26165754
MIRT087604	hsa-miR-20a-5p	ImmunofluorescenceImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	26165754
MIRT805210	hsa-let-7a	CLIP-seq
MIRT805211	hsa-let-7b	CLIP-seq
MIRT805212	hsa-let-7c	CLIP-seq
MIRT805213	hsa-let-7d	CLIP-seq
MIRT805214	hsa-let-7e	CLIP-seq
MIRT805215	hsa-let-7f	CLIP-seq
MIRT805216	hsa-let-7g	CLIP-seq
MIRT805217	hsa-let-7i	CLIP-seq
MIRT805218	hsa-miR-1244	CLIP-seq
MIRT805219	hsa-miR-1291	CLIP-seq
MIRT805220	hsa-miR-1294	CLIP-seq
MIRT805221	hsa-miR-1295	CLIP-seq
MIRT805222	hsa-miR-146b-3p	CLIP-seq
MIRT805223	hsa-miR-1914	CLIP-seq
MIRT805224	hsa-miR-202	CLIP-seq
MIRT805225	hsa-miR-3150b-3p	CLIP-seq
MIRT805226	hsa-miR-3202	CLIP-seq
MIRT805227	hsa-miR-325	CLIP-seq
MIRT805228	hsa-miR-3591-3p	CLIP-seq
MIRT805229	hsa-miR-3612	CLIP-seq
MIRT805230	hsa-miR-361-3p	CLIP-seq
MIRT805231	hsa-miR-3619-3p	CLIP-seq
MIRT805232	hsa-miR-3688-3p	CLIP-seq
MIRT805233	hsa-miR-3919	CLIP-seq
MIRT805234	hsa-miR-3925-5p	CLIP-seq
MIRT805235	hsa-miR-3974	CLIP-seq
MIRT805236	hsa-miR-4255	CLIP-seq
MIRT805237	hsa-miR-4443	CLIP-seq
MIRT805238	hsa-miR-4458	CLIP-seq
MIRT805239	hsa-miR-4493	CLIP-seq
MIRT805240	hsa-miR-4500	CLIP-seq
MIRT805241	hsa-miR-4533	CLIP-seq
MIRT805242	hsa-miR-4689	CLIP-seq
MIRT805243	hsa-miR-4695-5p	CLIP-seq
MIRT805244	hsa-miR-4710	CLIP-seq
MIRT805245	hsa-miR-4717-5p	CLIP-seq
MIRT805246	hsa-miR-4747-5p	CLIP-seq
MIRT805247	hsa-miR-4781-5p	CLIP-seq
MIRT805248	hsa-miR-4784	CLIP-seq
MIRT805249	hsa-miR-4792	CLIP-seq
MIRT805250	hsa-miR-493	CLIP-seq
MIRT805251	hsa-miR-650	CLIP-seq
MIRT805252	hsa-miR-744	CLIP-seq
MIRT805253	hsa-miR-98	CLIP-seq
MIRT805254	hsa-miR-106a	CLIP-seq
MIRT805255	hsa-miR-106b	CLIP-seq
MIRT805256	hsa-miR-130a	CLIP-seq
MIRT805257	hsa-miR-130b	CLIP-seq
MIRT805258	hsa-miR-142-5p	CLIP-seq
MIRT805259	hsa-miR-17	CLIP-seq
MIRT805260	hsa-miR-19a	CLIP-seq
MIRT805261	hsa-miR-19b	CLIP-seq
MIRT805262	hsa-miR-20a	CLIP-seq
MIRT805263	hsa-miR-20b	CLIP-seq
MIRT805264	hsa-miR-301a	CLIP-seq
MIRT805265	hsa-miR-301b	CLIP-seq
MIRT805266	hsa-miR-3609	CLIP-seq
MIRT805267	hsa-miR-3666	CLIP-seq
MIRT805268	hsa-miR-4295	CLIP-seq
MIRT805269	hsa-miR-454	CLIP-seq
MIRT805270	hsa-miR-4796-3p	CLIP-seq
MIRT805271	hsa-miR-519a	CLIP-seq
MIRT805272	hsa-miR-519b-3p	CLIP-seq
MIRT805273	hsa-miR-519c-3p	CLIP-seq
MIRT805274	hsa-miR-519d	CLIP-seq
MIRT805275	hsa-miR-548ah	CLIP-seq
MIRT805276	hsa-miR-548n	CLIP-seq
MIRT805277	hsa-miR-548t	CLIP-seq
MIRT805278	hsa-miR-93	CLIP-seq
MIRT805279	hsa-miR-3187-3p	CLIP-seq
MIRT805280	hsa-miR-3926	CLIP-seq
MIRT805281	hsa-miR-4435	CLIP-seq
MIRT805282	hsa-miR-4701-5p	CLIP-seq
MIRT805283	hsa-miR-4803	CLIP-seq
MIRT805284	hsa-miR-548s	CLIP-seq
MIRT805285	hsa-miR-588	CLIP-seq
MIRT805286	hsa-miR-1321	CLIP-seq
MIRT805258	hsa-miR-142-5p	CLIP-seq
MIRT805287	hsa-miR-181a	CLIP-seq
MIRT805288	hsa-miR-181b	CLIP-seq
MIRT805289	hsa-miR-181c	CLIP-seq
MIRT805290	hsa-miR-181d	CLIP-seq
MIRT805291	hsa-miR-214	CLIP-seq
MIRT805292	hsa-miR-3137	CLIP-seq
MIRT805293	hsa-miR-3619-5p	CLIP-seq
MIRT805294	hsa-miR-4262	CLIP-seq
MIRT805295	hsa-miR-4270	CLIP-seq
MIRT805296	hsa-miR-4291	CLIP-seq
MIRT805297	hsa-miR-4441	CLIP-seq
MIRT805298	hsa-miR-4703-3p	CLIP-seq
MIRT805299	hsa-miR-4728-5p	CLIP-seq
MIRT805300	hsa-miR-4733-3p	CLIP-seq
MIRT805301	hsa-miR-4739	CLIP-seq
MIRT805302	hsa-miR-4756-5p	CLIP-seq
MIRT805303	hsa-miR-642b	CLIP-seq
MIRT805304	hsa-miR-7	CLIP-seq
MIRT805305	hsa-miR-761	CLIP-seq
MIRT805306	hsa-miR-922	CLIP-seq
MIRT805210	hsa-let-7a	CLIP-seq
MIRT805211	hsa-let-7b	CLIP-seq
MIRT805212	hsa-let-7c	CLIP-seq
MIRT805213	hsa-let-7d	CLIP-seq
MIRT805214	hsa-let-7e	CLIP-seq
MIRT805215	hsa-let-7f	CLIP-seq
MIRT805216	hsa-let-7g	CLIP-seq
MIRT805217	hsa-let-7i	CLIP-seq
MIRT805218	hsa-miR-1244	CLIP-seq
MIRT1937764	hsa-miR-1257	CLIP-seq
MIRT805219	hsa-miR-1291	CLIP-seq
MIRT805220	hsa-miR-1294	CLIP-seq
MIRT805221	hsa-miR-1295	CLIP-seq
MIRT1937765	hsa-miR-1302	CLIP-seq
MIRT1937766	hsa-miR-1305	CLIP-seq
MIRT805286	hsa-miR-1321	CLIP-seq
MIRT805222	hsa-miR-146b-3p	CLIP-seq
MIRT805287	hsa-miR-181a	CLIP-seq
MIRT805288	hsa-miR-181b	CLIP-seq
MIRT805289	hsa-miR-181c	CLIP-seq
MIRT805290	hsa-miR-181d	CLIP-seq
MIRT1937767	hsa-miR-191	CLIP-seq
MIRT805223	hsa-miR-1914	CLIP-seq
MIRT805224	hsa-miR-202	CLIP-seq
MIRT1937768	hsa-miR-218	CLIP-seq
MIRT1937769	hsa-miR-2467-3p	CLIP-seq
MIRT1937770	hsa-miR-3122	CLIP-seq
MIRT805292	hsa-miR-3137	CLIP-seq
MIRT1937771	hsa-miR-3147	CLIP-seq
MIRT805225	hsa-miR-3150b-3p	CLIP-seq
MIRT805226	hsa-miR-3202	CLIP-seq
MIRT805227	hsa-miR-325	CLIP-seq
MIRT805230	hsa-miR-361-3p	CLIP-seq
MIRT1937772	hsa-miR-3646	CLIP-seq
MIRT805232	hsa-miR-3688-3p	CLIP-seq
MIRT1937773	hsa-miR-3913-5p	CLIP-seq
MIRT805235	hsa-miR-3974	CLIP-seq
MIRT805236	hsa-miR-4255	CLIP-seq
MIRT805294	hsa-miR-4262	CLIP-seq
MIRT805295	hsa-miR-4270	CLIP-seq
MIRT1937774	hsa-miR-4298	CLIP-seq
MIRT1937775	hsa-miR-4303	CLIP-seq
MIRT1937776	hsa-miR-4325	CLIP-seq
MIRT1937777	hsa-miR-4422	CLIP-seq
MIRT1937778	hsa-miR-4425	CLIP-seq
MIRT1937779	hsa-miR-4426	CLIP-seq
MIRT805297	hsa-miR-4441	CLIP-seq
MIRT805238	hsa-miR-4458	CLIP-seq
MIRT805240	hsa-miR-4500	CLIP-seq
MIRT805241	hsa-miR-4533	CLIP-seq
MIRT1937780	hsa-miR-4647	CLIP-seq
MIRT1937781	hsa-miR-4662b	CLIP-seq
MIRT805242	hsa-miR-4689	CLIP-seq
MIRT805243	hsa-miR-4695-5p	CLIP-seq
MIRT805298	hsa-miR-4703-3p	CLIP-seq
MIRT805244	hsa-miR-4710	CLIP-seq
MIRT805245	hsa-miR-4717-5p	CLIP-seq
MIRT805299	hsa-miR-4728-5p	CLIP-seq
MIRT805300	hsa-miR-4733-3p	CLIP-seq
MIRT805301	hsa-miR-4739	CLIP-seq
MIRT805302	hsa-miR-4756-5p	CLIP-seq
MIRT1937782	hsa-miR-4761-5p	CLIP-seq
MIRT805247	hsa-miR-4781-5p	CLIP-seq
MIRT805248	hsa-miR-4784	CLIP-seq
MIRT805249	hsa-miR-4792	CLIP-seq
MIRT805250	hsa-miR-493	CLIP-seq
MIRT1937783	hsa-miR-576-3p	CLIP-seq
MIRT1937784	hsa-miR-636	CLIP-seq
MIRT805303	hsa-miR-642b	CLIP-seq
MIRT1937785	hsa-miR-652	CLIP-seq
MIRT805252	hsa-miR-744	CLIP-seq
MIRT805253	hsa-miR-98	CLIP-seq
MIRT805210	hsa-let-7a	CLIP-seq
MIRT805211	hsa-let-7b	CLIP-seq
MIRT805212	hsa-let-7c	CLIP-seq
MIRT805213	hsa-let-7d	CLIP-seq
MIRT805214	hsa-let-7e	CLIP-seq
MIRT805215	hsa-let-7f	CLIP-seq
MIRT805216	hsa-let-7g	CLIP-seq
MIRT805217	hsa-let-7i	CLIP-seq
MIRT805254	hsa-miR-106a	CLIP-seq
MIRT805255	hsa-miR-106b	CLIP-seq
MIRT2177235	hsa-miR-1205	CLIP-seq
MIRT2177236	hsa-miR-1207-5p	CLIP-seq
MIRT805218	hsa-miR-1244	CLIP-seq
MIRT1937764	hsa-miR-1257	CLIP-seq
MIRT2177237	hsa-miR-1267	CLIP-seq
MIRT2177238	hsa-miR-1271	CLIP-seq
MIRT2177239	hsa-miR-1277	CLIP-seq
MIRT805219	hsa-miR-1291	CLIP-seq
MIRT805220	hsa-miR-1294	CLIP-seq
MIRT1937766	hsa-miR-1305	CLIP-seq
MIRT805286	hsa-miR-1321	CLIP-seq
MIRT2177240	hsa-miR-139-5p	CLIP-seq
MIRT2177241	hsa-miR-141	CLIP-seq
MIRT805222	hsa-miR-146b-3p	CLIP-seq
MIRT805259	hsa-miR-17	CLIP-seq
MIRT2177242	hsa-miR-188-5p	CLIP-seq
MIRT1937767	hsa-miR-191	CLIP-seq
MIRT805223	hsa-miR-1914	CLIP-seq
MIRT2177243	hsa-miR-200a	CLIP-seq
MIRT805224	hsa-miR-202	CLIP-seq
MIRT805262	hsa-miR-20a	CLIP-seq
MIRT805263	hsa-miR-20b	CLIP-seq
MIRT2177244	hsa-miR-2117	CLIP-seq
MIRT1937768	hsa-miR-218	CLIP-seq
MIRT2177245	hsa-miR-29a	CLIP-seq
MIRT2177246	hsa-miR-29b	CLIP-seq
MIRT2177247	hsa-miR-29c	CLIP-seq
MIRT2177248	hsa-miR-31	CLIP-seq
MIRT2177249	hsa-miR-3135	CLIP-seq
MIRT805292	hsa-miR-3137	CLIP-seq
MIRT805225	hsa-miR-3150b-3p	CLIP-seq
MIRT2177250	hsa-miR-3173-5p	CLIP-seq
MIRT2177251	hsa-miR-3174	CLIP-seq
MIRT2177252	hsa-miR-3176	CLIP-seq
MIRT805279	hsa-miR-3187-3p	CLIP-seq
MIRT805226	hsa-miR-3202	CLIP-seq
MIRT805227	hsa-miR-325	CLIP-seq
MIRT805266	hsa-miR-3609	CLIP-seq
MIRT805229	hsa-miR-3612	CLIP-seq
MIRT805230	hsa-miR-361-3p	CLIP-seq
MIRT2177253	hsa-miR-3616-3p	CLIP-seq
MIRT805231	hsa-miR-3619-3p	CLIP-seq
MIRT1937772	hsa-miR-3646	CLIP-seq
MIRT2177254	hsa-miR-3665	CLIP-seq
MIRT805232	hsa-miR-3688-3p	CLIP-seq
MIRT2177255	hsa-miR-383	CLIP-seq
MIRT805233	hsa-miR-3919	CLIP-seq
MIRT2177256	hsa-miR-3922-3p	CLIP-seq
MIRT805234	hsa-miR-3925-5p	CLIP-seq
MIRT805280	hsa-miR-3926	CLIP-seq
MIRT805235	hsa-miR-3974	CLIP-seq
MIRT805236	hsa-miR-4255	CLIP-seq
MIRT2177257	hsa-miR-4264	CLIP-seq
MIRT2177258	hsa-miR-4269	CLIP-seq
MIRT805295	hsa-miR-4270	CLIP-seq
MIRT2177259	hsa-miR-4276	CLIP-seq
MIRT2177260	hsa-miR-4302	CLIP-seq
MIRT1937775	hsa-miR-4303	CLIP-seq
MIRT1937776	hsa-miR-4325	CLIP-seq
MIRT1937777	hsa-miR-4422	CLIP-seq
MIRT1937779	hsa-miR-4426	CLIP-seq
MIRT805281	hsa-miR-4435	CLIP-seq
MIRT2177261	hsa-miR-4436b-3p	CLIP-seq
MIRT805297	hsa-miR-4441	CLIP-seq
MIRT805237	hsa-miR-4443	CLIP-seq
MIRT805238	hsa-miR-4458	CLIP-seq
MIRT805240	hsa-miR-4500	CLIP-seq
MIRT2177262	hsa-miR-4514	CLIP-seq
MIRT805241	hsa-miR-4533	CLIP-seq
MIRT2177263	hsa-miR-455-5p	CLIP-seq
MIRT2177264	hsa-miR-4639-5p	CLIP-seq
MIRT1937780	hsa-miR-4647	CLIP-seq
MIRT2177265	hsa-miR-4652-3p	CLIP-seq
MIRT1937781	hsa-miR-4662b	CLIP-seq
MIRT805242	hsa-miR-4689	CLIP-seq
MIRT2177266	hsa-miR-4692	CLIP-seq
MIRT805243	hsa-miR-4695-5p	CLIP-seq
MIRT2177267	hsa-miR-4699-3p	CLIP-seq
MIRT805282	hsa-miR-4701-5p	CLIP-seq
MIRT805298	hsa-miR-4703-3p	CLIP-seq
MIRT2177268	hsa-miR-4704-3p	CLIP-seq
MIRT805244	hsa-miR-4710	CLIP-seq
MIRT2177269	hsa-miR-4720-3p	CLIP-seq
MIRT805299	hsa-miR-4728-5p	CLIP-seq
MIRT805300	hsa-miR-4733-3p	CLIP-seq
MIRT2177270	hsa-miR-4736	CLIP-seq
MIRT805301	hsa-miR-4739	CLIP-seq
MIRT2177271	hsa-miR-4742-5p	CLIP-seq
MIRT805302	hsa-miR-4756-5p	CLIP-seq
MIRT2177272	hsa-miR-4762-5p	CLIP-seq
MIRT2177273	hsa-miR-4763-3p	CLIP-seq
MIRT2177274	hsa-miR-4772-5p	CLIP-seq
MIRT2177275	hsa-miR-4780	CLIP-seq
MIRT805247	hsa-miR-4781-5p	CLIP-seq
MIRT805248	hsa-miR-4784	CLIP-seq
MIRT805249	hsa-miR-4792	CLIP-seq
MIRT2177276	hsa-miR-4795-3p	CLIP-seq
MIRT805270	hsa-miR-4796-3p	CLIP-seq
MIRT805283	hsa-miR-4803	CLIP-seq
MIRT2177277	hsa-miR-4804-3p	CLIP-seq
MIRT805250	hsa-miR-493	CLIP-seq
MIRT805274	hsa-miR-519d	CLIP-seq
MIRT2177278	hsa-miR-548a-3p	CLIP-seq
MIRT805275	hsa-miR-548ah	CLIP-seq
MIRT2177279	hsa-miR-548al	CLIP-seq
MIRT2177280	hsa-miR-548b-3p	CLIP-seq
MIRT2177281	hsa-miR-548e	CLIP-seq
MIRT2177282	hsa-miR-548f	CLIP-seq
MIRT805284	hsa-miR-548s	CLIP-seq
MIRT2177283	hsa-miR-548v	CLIP-seq
MIRT1937783	hsa-miR-576-3p	CLIP-seq
MIRT805285	hsa-miR-588	CLIP-seq
MIRT2177284	hsa-miR-605	CLIP-seq
MIRT2177285	hsa-miR-623	CLIP-seq
MIRT1937784	hsa-miR-636	CLIP-seq
MIRT2177286	hsa-miR-645	CLIP-seq
MIRT805251	hsa-miR-650	CLIP-seq
MIRT1937785	hsa-miR-652	CLIP-seq
MIRT805252	hsa-miR-744	CLIP-seq
MIRT2177287	hsa-miR-769-5p	CLIP-seq
MIRT2177288	hsa-miR-874	CLIP-seq
MIRT805278	hsa-miR-93	CLIP-seq
MIRT2177289	hsa-miR-940	CLIP-seq
MIRT2177290	hsa-miR-96	CLIP-seq
MIRT805253	hsa-miR-98	CLIP-seq
MIRT805210	hsa-let-7a	CLIP-seq
MIRT805211	hsa-let-7b	CLIP-seq
MIRT805212	hsa-let-7c	CLIP-seq
MIRT805213	hsa-let-7d	CLIP-seq
MIRT805214	hsa-let-7e	CLIP-seq
MIRT805215	hsa-let-7f	CLIP-seq
MIRT805216	hsa-let-7g	CLIP-seq
MIRT805217	hsa-let-7i	CLIP-seq
MIRT805254	hsa-miR-106a	CLIP-seq
MIRT805255	hsa-miR-106b	CLIP-seq
MIRT2177235	hsa-miR-1205	CLIP-seq
MIRT2480720	hsa-miR-1224-3p	CLIP-seq
MIRT2480721	hsa-miR-1237	CLIP-seq
MIRT2177239	hsa-miR-1277	CLIP-seq
MIRT2480722	hsa-miR-1286	CLIP-seq
MIRT805219	hsa-miR-1291	CLIP-seq
MIRT805220	hsa-miR-1294	CLIP-seq
MIRT805256	hsa-miR-130a	CLIP-seq
MIRT805257	hsa-miR-130b	CLIP-seq
MIRT2480723	hsa-miR-1324	CLIP-seq
MIRT2177241	hsa-miR-141	CLIP-seq
MIRT805258	hsa-miR-142-5p	CLIP-seq
MIRT805222	hsa-miR-146b-3p	CLIP-seq
MIRT805259	hsa-miR-17	CLIP-seq
MIRT2177242	hsa-miR-188-5p	CLIP-seq
MIRT1937767	hsa-miR-191	CLIP-seq
MIRT2480724	hsa-miR-1912	CLIP-seq
MIRT805223	hsa-miR-1914	CLIP-seq
MIRT2480725	hsa-miR-197	CLIP-seq
MIRT2480726	hsa-miR-198	CLIP-seq
MIRT805260	hsa-miR-19a	CLIP-seq
MIRT805261	hsa-miR-19b	CLIP-seq
MIRT2177243	hsa-miR-200a	CLIP-seq
MIRT805224	hsa-miR-202	CLIP-seq
MIRT805262	hsa-miR-20a	CLIP-seq
MIRT805263	hsa-miR-20b	CLIP-seq
MIRT1937768	hsa-miR-218	CLIP-seq
MIRT1937769	hsa-miR-2467-3p	CLIP-seq
MIRT2177245	hsa-miR-29a	CLIP-seq
MIRT2177246	hsa-miR-29b	CLIP-seq
MIRT2177247	hsa-miR-29c	CLIP-seq
MIRT805264	hsa-miR-301a	CLIP-seq
MIRT805265	hsa-miR-301b	CLIP-seq
MIRT2480727	hsa-miR-3064-3p	CLIP-seq
MIRT2480728	hsa-miR-3130-5p	CLIP-seq
MIRT2177249	hsa-miR-3135	CLIP-seq
MIRT805225	hsa-miR-3150b-3p	CLIP-seq
MIRT2480729	hsa-miR-3182	CLIP-seq
MIRT2480730	hsa-miR-3184	CLIP-seq
MIRT2480731	hsa-miR-3192	CLIP-seq
MIRT805226	hsa-miR-3202	CLIP-seq
MIRT2480732	hsa-miR-326	CLIP-seq
MIRT2480733	hsa-miR-330-5p	CLIP-seq
MIRT805266	hsa-miR-3609	CLIP-seq
MIRT805230	hsa-miR-361-3p	CLIP-seq
MIRT2480734	hsa-miR-3622a-3p	CLIP-seq
MIRT2480735	hsa-miR-3622b-3p	CLIP-seq
MIRT805267	hsa-miR-3666	CLIP-seq
MIRT805232	hsa-miR-3688-3p	CLIP-seq
MIRT2480736	hsa-miR-3689a-3p	CLIP-seq
MIRT2480737	hsa-miR-3689c	CLIP-seq
MIRT2480738	hsa-miR-3689d	CLIP-seq
MIRT805233	hsa-miR-3919	CLIP-seq
MIRT805234	hsa-miR-3925-5p	CLIP-seq
MIRT805235	hsa-miR-3974	CLIP-seq
MIRT2480739	hsa-miR-423-5p	CLIP-seq
MIRT805268	hsa-miR-4295	CLIP-seq
MIRT2177260	hsa-miR-4302	CLIP-seq
MIRT1937775	hsa-miR-4303	CLIP-seq
MIRT2480740	hsa-miR-4314	CLIP-seq
MIRT1937776	hsa-miR-4325	CLIP-seq
MIRT1937777	hsa-miR-4422	CLIP-seq
MIRT1937779	hsa-miR-4426	CLIP-seq
MIRT805281	hsa-miR-4435	CLIP-seq
MIRT2480741	hsa-miR-4436a	CLIP-seq
MIRT2480742	hsa-miR-4438	CLIP-seq
MIRT805237	hsa-miR-4443	CLIP-seq
MIRT2480743	hsa-miR-4446-3p	CLIP-seq
MIRT2480744	hsa-miR-4453	CLIP-seq
MIRT2480745	hsa-miR-4455	CLIP-seq
MIRT805238	hsa-miR-4458	CLIP-seq
MIRT2480746	hsa-miR-4482	CLIP-seq
MIRT805240	hsa-miR-4500	CLIP-seq
MIRT805241	hsa-miR-4533	CLIP-seq
MIRT2480747	hsa-miR-4538	CLIP-seq
MIRT805269	hsa-miR-454	CLIP-seq
MIRT2480748	hsa-miR-4641	CLIP-seq
MIRT2480749	hsa-miR-4646-5p	CLIP-seq
MIRT1937780	hsa-miR-4647	CLIP-seq
MIRT2480750	hsa-miR-4649-3p	CLIP-seq
MIRT2480751	hsa-miR-4659a-3p	CLIP-seq
MIRT2480752	hsa-miR-4659b-3p	CLIP-seq
MIRT1937781	hsa-miR-4662b	CLIP-seq
MIRT805242	hsa-miR-4689	CLIP-seq
MIRT805243	hsa-miR-4695-5p	CLIP-seq
MIRT805244	hsa-miR-4710	CLIP-seq
MIRT2480753	hsa-miR-4722-3p	CLIP-seq
MIRT2480754	hsa-miR-4722-5p	CLIP-seq
MIRT805299	hsa-miR-4728-5p	CLIP-seq
MIRT2480755	hsa-miR-4755-3p	CLIP-seq
MIRT2480756	hsa-miR-4761-3p	CLIP-seq
MIRT2480757	hsa-miR-4778-3p	CLIP-seq
MIRT2480758	hsa-miR-4779	CLIP-seq
MIRT2177275	hsa-miR-4780	CLIP-seq
MIRT2480759	hsa-miR-4781-3p	CLIP-seq
MIRT805247	hsa-miR-4781-5p	CLIP-seq
MIRT805248	hsa-miR-4784	CLIP-seq
MIRT805249	hsa-miR-4792	CLIP-seq
MIRT805270	hsa-miR-4796-3p	CLIP-seq
MIRT805250	hsa-miR-493	CLIP-seq
MIRT2480760	hsa-miR-499-3p	CLIP-seq
MIRT2480761	hsa-miR-499a-3p	CLIP-seq
MIRT805271	hsa-miR-519a	CLIP-seq
MIRT805272	hsa-miR-519b-3p	CLIP-seq
MIRT805273	hsa-miR-519c-3p	CLIP-seq
MIRT805274	hsa-miR-519d	CLIP-seq
MIRT2480762	hsa-miR-520a-5p	CLIP-seq
MIRT2480763	hsa-miR-525-5p	CLIP-seq
MIRT2177278	hsa-miR-548a-3p	CLIP-seq
MIRT805275	hsa-miR-548ah	CLIP-seq
MIRT2177281	hsa-miR-548e	CLIP-seq
MIRT2177282	hsa-miR-548f	CLIP-seq
MIRT805276	hsa-miR-548n	CLIP-seq
MIRT805277	hsa-miR-548t	CLIP-seq
MIRT2480764	hsa-miR-567	CLIP-seq
MIRT2480765	hsa-miR-577	CLIP-seq
MIRT2480766	hsa-miR-609	CLIP-seq
MIRT2177285	hsa-miR-623	CLIP-seq
MIRT1937784	hsa-miR-636	CLIP-seq
MIRT2177286	hsa-miR-645	CLIP-seq
MIRT2480767	hsa-miR-648	CLIP-seq
MIRT1937785	hsa-miR-652	CLIP-seq
MIRT805304	hsa-miR-7	CLIP-seq
MIRT805252	hsa-miR-744	CLIP-seq
MIRT805278	hsa-miR-93	CLIP-seq
MIRT2480768	hsa-miR-942	CLIP-seq
MIRT805253	hsa-miR-98	CLIP-seq
MIRT805254	hsa-miR-106a	CLIP-seq
MIRT805255	hsa-miR-106b	CLIP-seq
MIRT805219	hsa-miR-1291	CLIP-seq
MIRT805256	hsa-miR-130a	CLIP-seq
MIRT805257	hsa-miR-130b	CLIP-seq
MIRT2480723	hsa-miR-1324	CLIP-seq
MIRT2177241	hsa-miR-141	CLIP-seq
MIRT805258	hsa-miR-142-5p	CLIP-seq
MIRT805222	hsa-miR-146b-3p	CLIP-seq
MIRT805259	hsa-miR-17	CLIP-seq
MIRT1937767	hsa-miR-191	CLIP-seq
MIRT805223	hsa-miR-1914	CLIP-seq
MIRT2480725	hsa-miR-197	CLIP-seq
MIRT2480726	hsa-miR-198	CLIP-seq
MIRT805260	hsa-miR-19a	CLIP-seq
MIRT805261	hsa-miR-19b	CLIP-seq
MIRT2177243	hsa-miR-200a	CLIP-seq
MIRT805262	hsa-miR-20a	CLIP-seq
MIRT805263	hsa-miR-20b	CLIP-seq
MIRT1937768	hsa-miR-218	CLIP-seq
MIRT1937769	hsa-miR-2467-3p	CLIP-seq
MIRT2177245	hsa-miR-29a	CLIP-seq
MIRT2177246	hsa-miR-29b	CLIP-seq
MIRT2177247	hsa-miR-29c	CLIP-seq
MIRT805264	hsa-miR-301a	CLIP-seq
MIRT805265	hsa-miR-301b	CLIP-seq
MIRT2177249	hsa-miR-3135	CLIP-seq
MIRT805225	hsa-miR-3150b-3p	CLIP-seq
MIRT2480730	hsa-miR-3184	CLIP-seq
MIRT805266	hsa-miR-3609	CLIP-seq
MIRT805267	hsa-miR-3666	CLIP-seq
MIRT805233	hsa-miR-3919	CLIP-seq
MIRT805234	hsa-miR-3925-5p	CLIP-seq
MIRT2480739	hsa-miR-423-5p	CLIP-seq
MIRT805268	hsa-miR-4295	CLIP-seq
MIRT2177260	hsa-miR-4302	CLIP-seq
MIRT1937775	hsa-miR-4303	CLIP-seq
MIRT1937776	hsa-miR-4325	CLIP-seq
MIRT1937777	hsa-miR-4422	CLIP-seq
MIRT1937779	hsa-miR-4426	CLIP-seq
MIRT805281	hsa-miR-4435	CLIP-seq
MIRT2480742	hsa-miR-4438	CLIP-seq
MIRT805269	hsa-miR-454	CLIP-seq
MIRT1937780	hsa-miR-4647	CLIP-seq
MIRT1937781	hsa-miR-4662b	CLIP-seq
MIRT805242	hsa-miR-4689	CLIP-seq
MIRT805243	hsa-miR-4695-5p	CLIP-seq
MIRT805244	hsa-miR-4710	CLIP-seq
MIRT2480756	hsa-miR-4761-3p	CLIP-seq
MIRT805247	hsa-miR-4781-5p	CLIP-seq
MIRT805248	hsa-miR-4784	CLIP-seq
MIRT805249	hsa-miR-4792	CLIP-seq
MIRT805270	hsa-miR-4796-3p	CLIP-seq
MIRT805271	hsa-miR-519a	CLIP-seq
MIRT805272	hsa-miR-519b-3p	CLIP-seq
MIRT805273	hsa-miR-519c-3p	CLIP-seq
MIRT805274	hsa-miR-519d	CLIP-seq
MIRT2480762	hsa-miR-520a-5p	CLIP-seq
MIRT2480763	hsa-miR-525-5p	CLIP-seq
MIRT805275	hsa-miR-548ah	CLIP-seq
MIRT2480766	hsa-miR-609	CLIP-seq
MIRT1937784	hsa-miR-636	CLIP-seq
MIRT2177286	hsa-miR-645	CLIP-seq
MIRT2480767	hsa-miR-648	CLIP-seq
MIRT1937785	hsa-miR-652	CLIP-seq
MIRT805304	hsa-miR-7	CLIP-seq
MIRT805252	hsa-miR-744	CLIP-seq
MIRT805278	hsa-miR-93	CLIP-seq
MIRT805266	hsa-miR-3609	CLIP-seq
MIRT805275	hsa-miR-548ah	CLIP-seq

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000045	Process	Autophagosome assembly	IDA	23202584
GO:0000045	Process	Autophagosome assembly	IEA
GO:0000045	Process	Autophagosome assembly	IMP	30778222
GO:0000045	Process	Autophagosome assembly	ISO
GO:0000045	Process	Autophagosome assembly	NAS	15620219
GO:0000421	Component	Autophagosome membrane	IBA
GO:0000421	Component	Autophagosome membrane	IDA	29317426
GO:0000421	Component	Autophagosome membrane	IEA
GO:0005515	Function	Protein binding	IPI	20562859, 23202584, 23262492, 23376921, 23392225, 24191030, 26347139, 28561066, 28890335, 31015422, 32296183, 32960676, 33087875, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005776	Component	Autophagosome	IEA
GO:0005776	Component	Autophagosome	ISS	15620219
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005930	Component	Axoneme	IEA
GO:0005930	Component	Axoneme	ISS
GO:0006501	Process	C-terminal protein lipidation	IDA	33586810
GO:0006914	Process	Autophagy	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016236	Process	Macroautophagy	IDA	29317426, 33586810
GO:0016236	Process	Macroautophagy	IEA
GO:0016236	Process	Macroautophagy	ISO
GO:0016236	Process	Macroautophagy	TAS
GO:0016237	Process	Microautophagy	IDA	29317426, 33586810
GO:0016237	Process	Microautophagy	IEA
GO:0019787	Function	Ubiquitin-like protein transferase activity	TAS
GO:0021766	Process	Hippocampus development	IEA
GO:0022038	Process	Corpus callosum development	IEA
GO:0030424	Component	Axon	IEA
GO:0034045	Component	Phagophore assembly site membrane	IBA
GO:0034045	Component	Phagophore assembly site membrane	IDA	32960676
GO:0034045	Component	Phagophore assembly site membrane	IEA
GO:0034045	Component	Phagophore assembly site membrane	ISO
GO:0034274	Component	Atg12-Atg5-Atg16 complex	IBA
GO:0034274	Component	Atg12-Atg5-Atg16 complex	IDA	29317426, 33586810
GO:0034274	Component	Atg12-Atg5-Atg16 complex	IEA
GO:0034274	Component	Atg12-Atg5-Atg16 complex	IPI	23202584
GO:0034497	Process	Protein localization to phagophore assembly site	IEA
GO:0034497	Process	Protein localization to phagophore assembly site	IMP	32960676
GO:0036020	Component	Endolysosome membrane	IDA	29317426
GO:0039689	Process	Negative stranded viral RNA replication	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	20562859, 23392225
GO:0043495	Function	Protein-membrane adaptor activity	IBA
GO:0043495	Function	Protein-membrane adaptor activity	IMP	30778222
GO:0045202	Component	Synapse	IEA
GO:0051020	Function	GTPase binding	IPI	25891078
GO:0051607	Process	Defense response to virus	IEA
GO:0097225	Component	Sperm midpiece	IEA
GO:0097225	Component	Sperm midpiece	ISS
GO:0098792	Process	Xenophagy	IEA
GO:0098930	Process	Axonal transport	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0120095	Component	Vacuole-isolation membrane contact site	IDA	28890335
GO:0140059	Process	Dendrite arborization	IEA
GO:1903860	Process	Negative regulation of dendrite extension	IEA

MIM	HGNC	e!Ensembl
610767	21498	ENSG00000085978

Q676U5

Protein name

Autophagy-related protein 16-1 (APG16-like 1)

Protein function

Plays an essential role in both canonical and non-canonical autophagy: interacts with ATG12-ATG5 to mediate the lipidation to ATG8 family proteins (MAP1LC3A, MAP1LC3B, MAP1LC3C, GABARAPL1, GABARAPL2 and GABARAP) (PubMed:23376921, PubMed:23392225

PDB

4GDK , 4GDL , 4NAW , 4TQ0 , 5D7G , 5NPV , 5NPW , 5NUV , 5ZYX , 7F69 , 7W36 , 7XFR , 8ZQG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08614	ATG16	16 → 206	Autophagy protein 16 (ATG16)	Coiled-coil
PF00400	WD40	313 → 350	WD domain, G-beta repeat	Repeat
PF00400	WD40	356 → 394	WD domain, G-beta repeat	Repeat
PF00400	WD40	398 → 436	WD domain, G-beta repeat	Repeat
PF00400	WD40	523 → 562	WD domain, G-beta repeat	Repeat
PF00400	WD40	566 → 604	WD domain, G-beta repeat	Repeat

Sequence

MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEK
HDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRK
DREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
HPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKG
SLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDN
ARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSES
IVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRV
VFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCK
AVLWAQY

Sequence length

607

Interactions

View interactions

	KEGG		Reactome
	Autophagy - other Autophagy - animal NOD-like receptor signaling pathway Shigellosis		Macroautophagy

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATG16L1-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory bowel disease 10	Uncertain significance	ClinVar CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Inflammatory bowel disease 10, susceptibility to	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (132)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	27335178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	28302031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26301688, 26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28952203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	33530273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25767270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	36082465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	34208077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	21811995	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASDB_DG	21150878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25767270		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29459719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31361973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33731709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Buruli Ulcer	Buruli ulcer	Pubtator	27128681, 32313116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Buruli Ulcer	Buruli ulcer	Pubtator	32313116	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26547861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28441070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28352666, 31959887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30236831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	30236831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	18047540, 19683022		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Palsy	Cerebral palsy	BEFREE	31031755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	28302031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	24012056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24012056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31484215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21099431, 23295687, 27230380, 28130498, 28390705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	25159710, 28542425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24715166, 25645662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24715166, 25645662, 30374741, 34894411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	GWASCAT_DG	26301688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	33530273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11171821, 17200669, 17455206, 17484864, 17534574, 17894849, 17921695, 18047540, 18088053, 18162085, 18200510, 18366306, 18438406, 18473763, 18521914 View all (120 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	LHGDN	17200669, 17484864, 17625155, 17894849, 17921695, 18366306, 18499543, 18698678, 18852889		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	17435756, 18438406		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASCAT_DG	17435756, 17554300, 18587394, 21102463, 22412388, 22936669, 23128233, 26192919, 26301688, 26974007, 28067908		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASDB_DG	17435756, 17554300, 17684544, 18587394, 21102463, 22412388, 22936669, 23128233		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	18438406, 18698678, 18715515, 18852889, 19185283, 20066736, 20117335, 20380008, 20637199, 20846217, 21548950, 21559399, 21734790, 21930071, 22275320 View all (35 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	17435756, 18438406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	17435756, 18438406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	40226707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34933019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	27893720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	36117315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	34208077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	27960588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28591717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Food intolerance (disorder)	Food Intolerance	BEFREE	29103907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	20616747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	40226707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	21513755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	18499543, 20066736, 21734790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35481288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	20697744		★★★★★ ★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	17435756, 18438406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	18162085, 28082357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Disease 10	Inflammatory Bowel Disease	UNIPROT_DG	17200669, 17435756, 17484864, 18047540, 18499543, 18985712, 19659808, 24553140, 24656308, 25645662, 27273576		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Inflammatory Bowel Disease 10	Inflammatory Bowel Disease	CTD_human_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17484864, 17894849, 18047540, 18162085, 18341487, 18499066, 18499543, 18671817, 18698678, 18753178, 19000829, 19262523, 19276991, 19491842, 19575361 View all (20 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17484864, 17894849, 18366306, 18698678		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	18698678, 20066736, 20082483, 20839241, 21088407, 24155895, 25159710, 27802154, 28542425, 29228965, 37312743, 37473877	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919, 28067908		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	26192919		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Diseases	Intestinal Diseases	BEFREE	20144769, 21987459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	18341487, 18671817, 21987459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29422997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33638615, 37088992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28761177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28591717, 29472524, 31340167, 31484215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31484215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	26301688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31451676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25060858	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28441070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	28761177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28253959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26547861, 30320370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25645662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27758042, 30736412, 31612776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	28302031		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27748080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27748080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	22684298	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	28761177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	38114939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	33530273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	27893720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	27893720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21521946, 22684298, 24715166, 25060858, 26365175, 26547861, 29048433, 31636955		★★★★★ ★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Crohn disease	Crohn disease	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28441070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29103907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	26030385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	39189559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28138700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	24522266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28279708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36958426, 38136993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28253959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26365175, 30256070, 32264916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26301688, 26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24012056, 32940422, 33469280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	BEFREE	21513755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	17435756, 18438406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23295687, 30208760		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	24791954, 28839236, 29358708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25060858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25060858, 28761177, 35481288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28761177, 29637616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28860495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26547861, 30320370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	34965181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26547861, 33906066, 34965181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25645662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25645662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25645662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11171821, 16494108, 17484864, 17894849, 18047540, 18366306, 18473763, 18500230, 19276991, 19491842, 20082483, 20222171, 22457781, 27335178, 27435106, 28542425, 28593437 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	17484864		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26301688, 26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30256070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	36082465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ATG16L1 (autophagy related 16 like 1)