Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55040
Gene name	Epsin 3
Gene symbol	EPN3
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17q21.33

Show/Hide all (83)

miRTarBase ID	miRNA	Experiments
MIRT967126	hsa-miR-1197	CLIP-seq
MIRT967127	hsa-miR-1205	CLIP-seq
MIRT967128	hsa-miR-1224-5p	CLIP-seq
MIRT967129	hsa-miR-1245	CLIP-seq
MIRT967130	hsa-miR-1825	CLIP-seq
MIRT967131	hsa-miR-198	CLIP-seq
MIRT967132	hsa-miR-199a-5p	CLIP-seq
MIRT967133	hsa-miR-199b-5p	CLIP-seq
MIRT967134	hsa-miR-203	CLIP-seq
MIRT967135	hsa-miR-2467-3p	CLIP-seq
MIRT967136	hsa-miR-3064-5p	CLIP-seq
MIRT967137	hsa-miR-3158-5p	CLIP-seq
MIRT967138	hsa-miR-3545-5p	CLIP-seq
MIRT967139	hsa-miR-3612	CLIP-seq
MIRT967140	hsa-miR-3646	CLIP-seq
MIRT967141	hsa-miR-3678-3p	CLIP-seq
MIRT967142	hsa-miR-3689a-5p	CLIP-seq
MIRT967143	hsa-miR-3689b	CLIP-seq
MIRT967144	hsa-miR-3689e	CLIP-seq
MIRT967145	hsa-miR-3689f	CLIP-seq
MIRT967146	hsa-miR-371-3p	CLIP-seq
MIRT967147	hsa-miR-371b-3p	CLIP-seq
MIRT967148	hsa-miR-383	CLIP-seq
MIRT967149	hsa-miR-4302	CLIP-seq
MIRT967150	hsa-miR-4443	CLIP-seq
MIRT967151	hsa-miR-4534	CLIP-seq
MIRT967152	hsa-miR-4751	CLIP-seq
MIRT967153	hsa-miR-4763-5p	CLIP-seq
MIRT967154	hsa-miR-4772-5p	CLIP-seq
MIRT967155	hsa-miR-4802-5p	CLIP-seq
MIRT967156	hsa-miR-485-5p	CLIP-seq
MIRT967157	hsa-miR-515-3p	CLIP-seq
MIRT967158	hsa-miR-519e	CLIP-seq
MIRT967159	hsa-miR-604	CLIP-seq
MIRT967160	hsa-miR-642b	CLIP-seq
MIRT967161	hsa-miR-647	CLIP-seq
MIRT967162	hsa-miR-650	CLIP-seq
MIRT1920408	hsa-miR-3192	CLIP-seq
MIRT1920409	hsa-miR-4300	CLIP-seq
MIRT1920410	hsa-miR-661	CLIP-seq
MIRT1920411	hsa-miR-920	CLIP-seq
MIRT1986493	hsa-miR-145	CLIP-seq
MIRT1986494	hsa-miR-4267	CLIP-seq
MIRT1986495	hsa-miR-4328	CLIP-seq
MIRT1986496	hsa-miR-4532	CLIP-seq
MIRT967153	hsa-miR-4763-5p	CLIP-seq
MIRT1986497	hsa-miR-4767	CLIP-seq
MIRT1986498	hsa-miR-4795-3p	CLIP-seq
MIRT1986499	hsa-miR-593	CLIP-seq
MIRT2221011	hsa-miR-1245b-5p	CLIP-seq
MIRT1986493	hsa-miR-145	CLIP-seq
MIRT2221012	hsa-miR-2115	CLIP-seq
MIRT2221013	hsa-miR-2116	CLIP-seq
MIRT2221014	hsa-miR-217	CLIP-seq
MIRT2221015	hsa-miR-3064-3p	CLIP-seq
MIRT2221016	hsa-miR-3142	CLIP-seq
MIRT2221017	hsa-miR-3164	CLIP-seq
MIRT2221018	hsa-miR-3180-5p	CLIP-seq
MIRT2221019	hsa-miR-33a	CLIP-seq
MIRT2221020	hsa-miR-33b	CLIP-seq
MIRT2221021	hsa-miR-3648	CLIP-seq
MIRT2221022	hsa-miR-3655	CLIP-seq
MIRT2221023	hsa-miR-3925-3p	CLIP-seq
MIRT1986494	hsa-miR-4267	CLIP-seq
MIRT2221024	hsa-miR-4289	CLIP-seq
MIRT2221025	hsa-miR-432	CLIP-seq
MIRT1986495	hsa-miR-4328	CLIP-seq
MIRT2221026	hsa-miR-4494	CLIP-seq
MIRT1986496	hsa-miR-4532	CLIP-seq
MIRT2221027	hsa-miR-4645-5p	CLIP-seq
MIRT2221028	hsa-miR-4650-5p	CLIP-seq
MIRT2221029	hsa-miR-4673	CLIP-seq
MIRT2221030	hsa-miR-4677-5p	CLIP-seq
MIRT2221031	hsa-miR-4713-3p	CLIP-seq
MIRT2221032	hsa-miR-4727-5p	CLIP-seq
MIRT1986497	hsa-miR-4767	CLIP-seq
MIRT2221033	hsa-miR-4769-3p	CLIP-seq
MIRT2221034	hsa-miR-4793-5p	CLIP-seq
MIRT1986498	hsa-miR-4795-3p	CLIP-seq
MIRT2221035	hsa-miR-520a-5p	CLIP-seq
MIRT2221036	hsa-miR-525-5p	CLIP-seq
MIRT2221037	hsa-miR-578	CLIP-seq
MIRT2221038	hsa-miR-766	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20709745
GO:0005543	Function	Phospholipid binding	IBA
GO:0005634	Component	Nucleus	IDA	11359770
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0006897	Process	Endocytosis	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	20709745
GO:0030125	Component	Clathrin vesicle coat	IBA
GO:0030136	Component	Clathrin-coated vesicle	IDA	11359770
GO:0030136	Component	Clathrin-coated vesicle	IEA
GO:0030276	Function	Clathrin binding	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11359770
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1990175	Function	EH domain binding	IEA

MIM	HGNC	e!Ensembl
607264	18235	ENSG00000049283

Q9H201

Protein name

Epsin-3 (EPS-15-interacting protein 3)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01417	ENTH	17 → 140	ENTH domain	Domain
PF02809	UIM	209 → 225	Ubiquitin interaction motif	Motif
PF02809	UIM	236 → 252	Ubiquitin interaction motif	Motif

Tissue specificity

TISSUE SPECIFICITY: Detected in migrating keratinocytes from wounded skin, but not in differentiating keratinocytes or in normal skin. Detected in chronic wounds, basal cell carcinoma and ulcerative colitis. {ECO:0000269|PubMed:11359770}.

Sequence

MTTSALRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFTEVMGML
WRRLNDSGKNWRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQG
VNVREKVKQVMALLKDEERLRQERTHALKTKERMALEGIGIGSGQLGFSRRYGEDYSRSR
GSPSSYNSSSSSPRYTSDLEQARPQTSGEEELQLQLALAMSREEAEKPVPPASHRDEDLQ
LQLALRLSRQEHEKEVRSWQGDGSPMANGAGAVVHHQRDREPEREERKEEEKLKTSQSSI
LDLADIFVPALAPPSTHCSADPWDIPGFRPNTEASGSSWGPSADPWSPIPSGTVLSRSQP
WDLTPMLSSSEPWGRTPVLPAGPPTTDPWALNSPHHKLPSTGADPWGASLETSDTPGGAS
TFDPFAKPPESTETKEGLEQALPSGKPSSPVELDLFGDPSPSSKQNGTKEPDALDLGILG
EALTQPSKEARACRTPESFLGPSASSLVNLDSLVKAPQVAKTRNPFLTGLSAPSPTNPFG
AGEPGRPTLNQMRTGSPALGLAGGPVGAPLGSMTYSASLPLPLSSVPAGLTLPASVSVFP
QAGAFAPQPLLPTPSSAGPRPPPPQTGTNPFL

Sequence length

632

Interactions

View interactions

	KEGG
	Endocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HALLOPEAU-SIEMENS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE, DIASTOLIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	27926932, 32541686, 34779498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28152424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27765924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	28152424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	28152424	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30226603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30226603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30226603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure, Diastolic	Heart Failure	CTD_human_DG	29556499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	32541686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21115825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27926932, 30226603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30226603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30226603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30226603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28152424	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

EPN3 (epsin 3)