Gene Gene information from NCBI Gene database.
Entrez ID 55038
Gene name Cell division cycle associated 4
Gene symbol CDCA4
Synonyms (NCBI Gene)
HEPPSEI-3/HEPP
Chromosome 14
Chromosome location 14q32.33
Summary This gene encodes a protein that belongs to the E2F family of transcription factors. This protein regulates E2F-dependent transcriptional activation and cell proliferation, mainly through the E2F/retinoblastoma protein pathway. It also functions in the re
miRNA miRNA information provided by mirtarbase database.
1033
miRTarBase ID miRNA Experiments Reference
MIRT004690 hsa-miR-107 FlowImmunoblotMicroarrayqRT-PCR 19688090
MIRT016572 hsa-miR-193b-3p Microarray 20304954
MIRT021556 hsa-miR-142-3p Microarray 17612493
MIRT024841 hsa-miR-215-5p Microarray 19074876
MIRT026782 hsa-miR-192-5p Microarray 19074876
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0003713 Function Transcription coactivator activity IBA
GO:0005515 Function Protein binding IPI 23455924, 32296183, 32814053
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612270 14625 ENSG00000170779
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BXL8
Protein name Cell division cycle-associated protein 4 (Hematopoietic progenitor protein)
Protein function May participate in the regulation of cell proliferation through the E2F/RB pathway. May be involved in molecular regulation of hematopoietic stem cells and progenitor cell lineage commitment and differentiation (By similarity). {ECO:0000250, ECO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06031 SERTA 37 72 SERTA motif Motif
Tissue specificity TISSUE SPECIFICITY: Highest levels of expression in the pancreas, thymus, testis, spleen, liver, placenta and leukocytes. Relatively low levels in the lung, kidney, prostate, ovary, small intestine and colon. Hardly detectable, if at all, in the brain, sk
Sequence
MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSV
LIANTVRQIQEE
MTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAWGQEGAHPAPGLGDG
HTQGPVSDLCPVTSAQAPRHLQSSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEEL
FSDVDSPYYDLDTVLTGMMGGARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVE
T
Sequence length 241
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
OLIGODENDROGLIOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Carcinoma Breast Carcinoma BEFREE 29257222
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 35251007 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 34772428 Associate
★☆☆☆☆
Found in Text Mining only
Chagas Disease Chagas disease Pubtator 35251007 Associate
★☆☆☆☆
Found in Text Mining only
Esophageal Neoplasms Esophageal neoplasm Pubtator 33794814 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 29257222
★☆☆☆☆
Found in Text Mining only
melanoma Melanoma BEFREE 27492455
★☆☆☆☆
Found in Text Mining only
Melanoma Melanoma Pubtator 34497853 Associate
★☆☆☆☆
Found in Text Mining only
Pancreatic Neoplasms Pancreatic neoplasm Pubtator 33437202 Associate
★☆☆☆☆
Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck Squamous cell carcinoma Pubtator 32716971 Associate
★☆☆☆☆
Found in Text Mining only