Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55024
Gene name	B cell scaffold protein with ankyrin repeats 1
Gene symbol	BANK1
Synonyms (NCBI Gene)	BANK
Chromosome	4
Chromosome location	4q24
Summary	The protein encoded by this gene is a B-cell-specific scaffold protein that functions in B-cell receptor-induced calcium mobilization from intracellular stores. This protein can also promote Lyn-mediated tyrosine phosphorylation of inositol 1,4,5-trisphos

322

Show/Hide all (322)

miRTarBase ID	miRNA	Experiments	Reference
MIRT452491	hsa-miR-6768-3p	HITS-CLIP	21572407
MIRT452489	hsa-miR-4662a-5p	HITS-CLIP	21572407
MIRT452488	hsa-miR-7641	HITS-CLIP	21572407
MIRT452491	hsa-miR-6768-3p	HITS-CLIP	23313552
MIRT452490	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT452489	hsa-miR-4662a-5p	HITS-CLIP	23313552
MIRT452488	hsa-miR-7641	HITS-CLIP	23313552
MIRT452491	hsa-miR-6768-3p	HITS-CLIP	23313552
MIRT452490	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT452489	hsa-miR-4662a-5p	HITS-CLIP	23313552
MIRT452488	hsa-miR-7641	HITS-CLIP	23313552
MIRT452491	hsa-miR-6768-3p	HITS-CLIP	23706177
MIRT452490	hsa-miR-590-3p	HITS-CLIP	23706177
MIRT452489	hsa-miR-4662a-5p	HITS-CLIP	23706177
MIRT452488	hsa-miR-7641	HITS-CLIP	23706177
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT452490	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT452488	hsa-miR-7641	PAR-CLIP	20371350
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT452490	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT452490	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT452488	hsa-miR-7641	PAR-CLIP	20371350
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT452490	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT452490	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT452488	hsa-miR-7641	PAR-CLIP	20371350
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT452490	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT452488	hsa-miR-7641	PAR-CLIP	20371350
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	21572407
MIRT452490	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT452488	hsa-miR-7641	PAR-CLIP	21572407
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	21572407
MIRT452490	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT452488	hsa-miR-7641	PAR-CLIP	21572407
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	21572407
MIRT452490	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT452488	hsa-miR-7641	PAR-CLIP	21572407
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	21572407
MIRT452490	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT452488	hsa-miR-7641	PAR-CLIP	21572407
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	22012620
MIRT452490	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	22012620
MIRT452488	hsa-miR-7641	PAR-CLIP	22012620
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	23446348
MIRT452490	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	23446348
MIRT452488	hsa-miR-7641	PAR-CLIP	23446348
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	23446348
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	23446348
MIRT452488	hsa-miR-7641	PAR-CLIP	23446348
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	23446348
MIRT452490	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	23446348
MIRT452488	hsa-miR-7641	PAR-CLIP	23446348
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	23446348
MIRT452490	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	23446348
MIRT452488	hsa-miR-7641	PAR-CLIP	23446348
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	24398324
MIRT452490	hsa-miR-590-3p	PAR-CLIP	24398324
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	24398324
MIRT452488	hsa-miR-7641	PAR-CLIP	24398324
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT452490	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	23592263
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT452490	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	23592263
MIRT452488	hsa-miR-7641	PAR-CLIP	23592263
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452490	hsa-miR-590-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452488	hsa-miR-7641	PAR-CLIP	26701625
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	27292025
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	27292025
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	27292025
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	27292025
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	27292025
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	27292025
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	27292025
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	27292025
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	27292025
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	27292025
MIRT452490	hsa-miR-590-3p	PAR-CLIP	27292025
MIRT452490	hsa-miR-590-3p	PAR-CLIP	27292025
MIRT452490	hsa-miR-590-3p	PAR-CLIP	27292025
MIRT452490	hsa-miR-590-3p	PAR-CLIP	27292025
MIRT452490	hsa-miR-590-3p	PAR-CLIP	27292025
MIRT452490	hsa-miR-590-3p	PAR-CLIP	27292025
MIRT452490	hsa-miR-590-3p	PAR-CLIP	27292025
MIRT452490	hsa-miR-590-3p	PAR-CLIP	27292025
MIRT452490	hsa-miR-590-3p	PAR-CLIP	27292025
MIRT452490	hsa-miR-590-3p	PAR-CLIP	27292025
MIRT452490	hsa-miR-590-3p	PAR-CLIP	27292025
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	27292025
MIRT452488	hsa-miR-7641	PAR-CLIP	27292025
MIRT452488	hsa-miR-7641	PAR-CLIP	27292025
MIRT452488	hsa-miR-7641	PAR-CLIP	27292025
MIRT452488	hsa-miR-7641	PAR-CLIP	27292025
MIRT452488	hsa-miR-7641	PAR-CLIP	27292025
MIRT452488	hsa-miR-7641	PAR-CLIP	27292025
MIRT452488	hsa-miR-7641	PAR-CLIP	27292025
MIRT452488	hsa-miR-7641	PAR-CLIP	27292025
MIRT452488	hsa-miR-7641	PAR-CLIP	27292025
MIRT452488	hsa-miR-7641	PAR-CLIP	27292025
MIRT452489	hsa-miR-4662a-5p	HITS-CLIP	27418678
MIRT452489	hsa-miR-4662a-5p	HITS-CLIP	27418678
MIRT452489	hsa-miR-4662a-5p	HITS-CLIP	27418678
MIRT452489	hsa-miR-4662a-5p	HITS-CLIP	27418678
MIRT452491	hsa-miR-6768-3p	HITS-CLIP	27418678
MIRT452491	hsa-miR-6768-3p	HITS-CLIP	27418678
MIRT452491	hsa-miR-6768-3p	HITS-CLIP	27418678
MIRT452491	hsa-miR-6768-3p	HITS-CLIP	27418678
MIRT452488	hsa-miR-7641	HITS-CLIP	27418678
MIRT452488	hsa-miR-7641	HITS-CLIP	27418678
MIRT452488	hsa-miR-7641	HITS-CLIP	27418678
MIRT452488	hsa-miR-7641	HITS-CLIP	27418678
MIRT452491	hsa-miR-6768-3p	HITS-CLIP	21572407
MIRT452489	hsa-miR-4662a-5p	HITS-CLIP	21572407
MIRT452488	hsa-miR-7641	HITS-CLIP	21572407
MIRT452491	hsa-miR-6768-3p	HITS-CLIP	23313552
MIRT452490	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT452489	hsa-miR-4662a-5p	HITS-CLIP	23313552
MIRT452488	hsa-miR-7641	HITS-CLIP	23313552
MIRT452491	hsa-miR-6768-3p	HITS-CLIP	23313552
MIRT452490	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT452489	hsa-miR-4662a-5p	HITS-CLIP	23313552
MIRT452488	hsa-miR-7641	HITS-CLIP	23313552
MIRT452491	hsa-miR-6768-3p	HITS-CLIP	23706177
MIRT452490	hsa-miR-590-3p	HITS-CLIP	23706177
MIRT452489	hsa-miR-4662a-5p	HITS-CLIP	23706177
MIRT452488	hsa-miR-7641	HITS-CLIP	23706177
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT452490	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT452488	hsa-miR-7641	PAR-CLIP	20371350
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT452490	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT452490	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT452488	hsa-miR-7641	PAR-CLIP	20371350
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT452490	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT452490	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT452488	hsa-miR-7641	PAR-CLIP	20371350
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT452490	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	20371350
MIRT452488	hsa-miR-7641	PAR-CLIP	20371350
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	21572407
MIRT452490	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT452488	hsa-miR-7641	PAR-CLIP	21572407
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	21572407
MIRT452490	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT452488	hsa-miR-7641	PAR-CLIP	21572407
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	21572407
MIRT452490	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT452488	hsa-miR-7641	PAR-CLIP	21572407
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	21572407
MIRT452490	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT452488	hsa-miR-7641	PAR-CLIP	21572407
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	22012620
MIRT452490	hsa-miR-590-3p	PAR-CLIP	22012620
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	22012620
MIRT452488	hsa-miR-7641	PAR-CLIP	22012620
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	23446348
MIRT452490	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	23446348
MIRT452488	hsa-miR-7641	PAR-CLIP	23446348
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	23446348
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	23446348
MIRT452488	hsa-miR-7641	PAR-CLIP	23446348
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	23446348
MIRT452490	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	23446348
MIRT452488	hsa-miR-7641	PAR-CLIP	23446348
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	23446348
MIRT452490	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	23446348
MIRT452488	hsa-miR-7641	PAR-CLIP	23446348
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	24398324
MIRT452490	hsa-miR-590-3p	PAR-CLIP	24398324
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	24398324
MIRT452488	hsa-miR-7641	PAR-CLIP	24398324
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT452490	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	23592263
MIRT452491	hsa-miR-6768-3p	PAR-CLIP	23592263
MIRT452490	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT452489	hsa-miR-4662a-5p	PAR-CLIP	23592263
MIRT452488	hsa-miR-7641	PAR-CLIP	23592263
MIRT815798	hsa-miR-1305	CLIP-seq
MIRT815799	hsa-miR-3671	CLIP-seq
MIRT815800	hsa-miR-4275	CLIP-seq
MIRT815801	hsa-miR-607	CLIP-seq
MIRT815802	hsa-miR-3127-5p	CLIP-seq
MIRT815803	hsa-miR-409-3p	CLIP-seq
MIRT815804	hsa-miR-4307	CLIP-seq
MIRT2180078	hsa-miR-369-3p	CLIP-seq
MIRT2180079	hsa-miR-374a	CLIP-seq
MIRT2180080	hsa-miR-374b	CLIP-seq
MIRT2180081	hsa-miR-4528	CLIP-seq
MIRT2180082	hsa-miR-544	CLIP-seq
MIRT2180083	hsa-miR-548p	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0002020	Function	Protease binding	IPI	23555801
GO:0002682	Process	Regulation of immune system process	IEA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IPI	11782428, 23555801
GO:0005515	Function	Protein binding	IPI	11782428, 21978998, 23555801
GO:0007165	Process	Signal transduction	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0035591	Function	Signaling adaptor activity	IDA	23555801
GO:0042113	Process	B cell activation	IBA
GO:0042113	Process	B cell activation	IDA	11782428
GO:0042113	Process	B cell activation	IEA
GO:0043274	Function	Phospholipase binding	IPI	23555801
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0045947	Process	Negative regulation of translational initiation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	23555801
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IMP	11782428
GO:0050853	Process	B cell receptor signaling pathway	TAS	23555801
GO:0050869	Process	Negative regulation of B cell activation	IBA
GO:0050869	Process	Negative regulation of B cell activation	IEA
GO:0051246	Process	Regulation of protein metabolic process	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IBA
GO:1990782	Function	Protein tyrosine kinase binding	IPI	11782428, 23555801

MIM	HGNC	e!Ensembl
610292	18233	ENSG00000153064

Q8NDB2

Protein name

B-cell scaffold protein with ankyrin repeats

Protein function

Involved in B-cell receptor (BCR)-induced Ca(2+) mobilization from intracellular stores. Promotes Lyn-mediated phosphorylation of IP3 receptors 1 and 2.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18567	TIR_3	28 → 154	Toll/interleukin-1 receptor domain	Domain
PF14545	DBB	199 → 328	Dof, BCAP, and BANK (DBB) motif,	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in B-cell but not T-cell or myeloid cell lines. Highest expression in CD19(+) B-cells, with very low expression in other cell populations. {ECO:0000269|PubMed:11782428, ECO:0000269|PubMed:18204447}.

Sequence

MLPAAPGKGLGSPDPAPCGPAPPGNTKDIIMIYEEDAEEWALYLTEVFLHVVKREAILLY
RLENFSFRHLELLNLTSYKCKLLILSNSLLRDLTPKKCQFLEKILHSPKSVVTLLCGVKS
SDQLYELLNISQSRWEISTEQEPEDYISVIQSIIFKDSEDYFEVNIPTDLRAKHSGEISE
RKEIEELSEASRNTIPLAVVLPTEIPCENPGEIFIILRDEVIGDTVEVEFTSSNKRIRTR
PALWNKKVWCMKALEFPAGSVHVNVYCDGIVKATTKIKYYPTAKAKECLFRMADSGESLC
QNSIEELDGVLTSIFKHEIPYYEFQSLQTEICSQNKYTHFKELPTLLHCAAKFGLKNLAI
HLLQCSGATWASKMKNMEGSDPAHIAERHGHKELKKIFEDFSIQEIDINNEQENDYEEDI
ASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPLEVGSESS
EDQYDDLYVFIPGADPENNSQEPLMSSRPPLPPPRPVANAFQLERPHFTLPGTMVEGQME
RSQNWGHPGVRQETGDEPKGEKEKKEEEKEQEEEEDPYTFAEIDDSEYDMILANLSIKKK
TGSRSFIINRPPAPTPRPTSIPPKEETTPYIAQVFQQKTARRQSDDDKFCGLPKKQDRAR
IESPAFSTLRGCLTDGQEELILLQEKVKNGKMSMDEALEKFKHWQMGKSGLEMIQQEKLR
QLRDCIIGKRPEEENVYNKLTIVHHPGGKETAHNENKFYNVHFSNKLPARPQVEKEFGFC
CKKDH

Sequence length

785

Interactions

View interactions

	KEGG
	B cell receptor signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (41)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGIOEDEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROIDITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE SCLERODERMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic lupus erythematosus	Benign; Likely benign	ClinVar CTD, GWAS catalog, Orphanet CTD, GWAS catalog, Orphanet CTD, GWAS catalog, Orphanet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
SYSTEMIC SCLERODERMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Variant of unknown significance	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (55)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	BEFREE	23065315, 29370826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19180476, 28925718	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22003931, 23065315, 23899688, 28466820, 30016332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	30096841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	26956414, 28165464		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASDB_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	23128233, 26192919, 26974007, 28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	30145638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24342660		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Scleroderma	Scleroderma	BEFREE	19815934, 19877059		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	BEFREE	31553483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	31553483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	20472928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	27313329	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	27313329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	27313329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	24127308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	24127308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23406209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	20007581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	33815360	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	18204447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	27111861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	27111861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	19339986, 27816669, 31101814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19180476, 19339986, 19357697, 19442287, 20169177, 21792837, 21900951, 21978998, 25882064, 26821283, 27816669, 29070082, 30096841, 32677764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	19339986, 27816669, 31101814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18204447, 19180476, 19339986, 19357697, 20947545, 21078628, 21208380, 21408207, 21900951, 21978998, 23646104, 25524556, 26420661, 27816669, 28466820, 31101814, 31134304 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18204447		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	18204447		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	18204447		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	18204447, 26502338, 28714469		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	ORPHANET_DG	21900951, 21978998, 22039224, 22654485, 23943494		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	19339986, 27816669, 31101814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	19644876, 25524556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	26522721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21989138		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19180476, 19714582, 23646104, 28466820, 28925718, 29370826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	20090527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	19877059, 27111861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	19877059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29070082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	26956414, 28165464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	23065315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28146432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic lupus erythematosus	Systemic lupus erythematosus	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Systemic Scleroderma	Scleroderma	BEFREE	19815934, 19877059, 20090527, 21480188, 21961844		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Diseases	Thyroid Diseases	BEFREE	24127308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

BANK1 (B cell scaffold protein with ankyrin repeats 1)