Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55022
Gene name	Phosphotyrosine interaction domain containing 1
Gene symbol	PID1
Synonyms (NCBI Gene)	HMFN2073NYGGF4P-CLI1PCLI1
Chromosome	2
Chromosome location	2q36.3

145

Show/Hide all (145)

miRTarBase ID	miRNA	Experiments
MIRT1233034	hsa-miR-1271	CLIP-seq
MIRT1233035	hsa-miR-182	CLIP-seq
MIRT1233036	hsa-miR-3065-3p	CLIP-seq
MIRT1233037	hsa-miR-3157-5p	CLIP-seq
MIRT1233038	hsa-miR-34a	CLIP-seq
MIRT1233039	hsa-miR-34c-5p	CLIP-seq
MIRT1233040	hsa-miR-3620	CLIP-seq
MIRT1233041	hsa-miR-4286	CLIP-seq
MIRT1233042	hsa-miR-4301	CLIP-seq
MIRT1233043	hsa-miR-449a	CLIP-seq
MIRT1233044	hsa-miR-449b	CLIP-seq
MIRT1233045	hsa-miR-4680-3p	CLIP-seq
MIRT1233046	hsa-miR-4691-3p	CLIP-seq
MIRT1233047	hsa-miR-548ac	CLIP-seq
MIRT1233048	hsa-miR-548ae	CLIP-seq
MIRT1233049	hsa-miR-548aj	CLIP-seq
MIRT1233050	hsa-miR-548am	CLIP-seq
MIRT1233051	hsa-miR-548d-3p	CLIP-seq
MIRT1233052	hsa-miR-548x	CLIP-seq
MIRT1233053	hsa-miR-548z	CLIP-seq
MIRT1233054	hsa-miR-96	CLIP-seq
MIRT1233055	hsa-miR-3138	CLIP-seq
MIRT1233056	hsa-miR-3153	CLIP-seq
MIRT1233057	hsa-miR-3154	CLIP-seq
MIRT1233058	hsa-miR-3179	CLIP-seq
MIRT1233059	hsa-miR-583	CLIP-seq
MIRT2593544	hsa-miR-103a	CLIP-seq
MIRT2593545	hsa-miR-107	CLIP-seq
MIRT2593546	hsa-miR-1251	CLIP-seq
MIRT2593547	hsa-miR-1267	CLIP-seq
MIRT2593548	hsa-miR-127-5p	CLIP-seq
MIRT2593549	hsa-miR-1324	CLIP-seq
MIRT2593550	hsa-miR-150	CLIP-seq
MIRT2593551	hsa-miR-154	CLIP-seq
MIRT2593552	hsa-miR-15a	CLIP-seq
MIRT2593553	hsa-miR-15b	CLIP-seq
MIRT2593554	hsa-miR-16	CLIP-seq
MIRT2593555	hsa-miR-186	CLIP-seq
MIRT2593556	hsa-miR-188-3p	CLIP-seq
MIRT2593557	hsa-miR-193a-5p	CLIP-seq
MIRT2593558	hsa-miR-195	CLIP-seq
MIRT2593559	hsa-miR-204	CLIP-seq
MIRT2593560	hsa-miR-211	CLIP-seq
MIRT2593561	hsa-miR-3133	CLIP-seq
MIRT2593562	hsa-miR-3136-5p	CLIP-seq
MIRT2593563	hsa-miR-3147	CLIP-seq
MIRT2593564	hsa-miR-3166	CLIP-seq
MIRT2593565	hsa-miR-3170	CLIP-seq
MIRT2593566	hsa-miR-3182	CLIP-seq
MIRT2593567	hsa-miR-3614-5p	CLIP-seq
MIRT2593568	hsa-miR-3619-3p	CLIP-seq
MIRT2593569	hsa-miR-3622b-5p	CLIP-seq
MIRT2593570	hsa-miR-3664-5p	CLIP-seq
MIRT2593571	hsa-miR-3682-5p	CLIP-seq
MIRT2593572	hsa-miR-3686	CLIP-seq
MIRT2593573	hsa-miR-369-3p	CLIP-seq
MIRT2593574	hsa-miR-371b-3p	CLIP-seq
MIRT2593575	hsa-miR-374a	CLIP-seq
MIRT2593576	hsa-miR-374b	CLIP-seq
MIRT2593577	hsa-miR-376c	CLIP-seq
MIRT2593578	hsa-miR-3912	CLIP-seq
MIRT2593579	hsa-miR-424	CLIP-seq
MIRT2593580	hsa-miR-4305	CLIP-seq
MIRT2593581	hsa-miR-4310	CLIP-seq
MIRT2593582	hsa-miR-4425	CLIP-seq
MIRT2593583	hsa-miR-4426	CLIP-seq
MIRT2593584	hsa-miR-4439	CLIP-seq
MIRT2593585	hsa-miR-4446-5p	CLIP-seq
MIRT2593586	hsa-miR-4476	CLIP-seq
MIRT2593587	hsa-miR-4477b	CLIP-seq
MIRT2593588	hsa-miR-4480	CLIP-seq
MIRT2593589	hsa-miR-4522	CLIP-seq
MIRT2593590	hsa-miR-4533	CLIP-seq
MIRT2593591	hsa-miR-4633-3p	CLIP-seq
MIRT2593592	hsa-miR-4647	CLIP-seq
MIRT2593593	hsa-miR-4652-3p	CLIP-seq
MIRT2593594	hsa-miR-4659a-5p	CLIP-seq
MIRT2593595	hsa-miR-4659b-5p	CLIP-seq
MIRT2593596	hsa-miR-4662a-3p	CLIP-seq
MIRT2593597	hsa-miR-4662b	CLIP-seq
MIRT2593598	hsa-miR-4700-3p	CLIP-seq
MIRT2593599	hsa-miR-4711-5p	CLIP-seq
MIRT2593600	hsa-miR-4713-5p	CLIP-seq
MIRT2593601	hsa-miR-4725-5p	CLIP-seq
MIRT2593602	hsa-miR-4728-3p	CLIP-seq
MIRT2593603	hsa-miR-4729	CLIP-seq
MIRT2593604	hsa-miR-4742-3p	CLIP-seq
MIRT2593605	hsa-miR-4749-3p	CLIP-seq
MIRT2593606	hsa-miR-4755-5p	CLIP-seq
MIRT2593607	hsa-miR-4771	CLIP-seq
MIRT2593608	hsa-miR-4776-3p	CLIP-seq
MIRT2593609	hsa-miR-4777-5p	CLIP-seq
MIRT2593610	hsa-miR-4778-5p	CLIP-seq
MIRT2593611	hsa-miR-497	CLIP-seq
MIRT2593612	hsa-miR-499a-5p	CLIP-seq
MIRT2593613	hsa-miR-504	CLIP-seq
MIRT2593614	hsa-miR-532-3p	CLIP-seq
MIRT2593615	hsa-miR-548b-3p	CLIP-seq
MIRT2593616	hsa-miR-548n	CLIP-seq
MIRT2593617	hsa-miR-556-3p	CLIP-seq
MIRT2593618	hsa-miR-570	CLIP-seq
MIRT2593619	hsa-miR-574-5p	CLIP-seq
MIRT2593620	hsa-miR-590-3p	CLIP-seq
MIRT2593621	hsa-miR-623	CLIP-seq
MIRT2593622	hsa-miR-628-5p	CLIP-seq
MIRT2593623	hsa-miR-651	CLIP-seq
MIRT2593624	hsa-miR-943	CLIP-seq
MIRT2593544	hsa-miR-103a	CLIP-seq
MIRT2593545	hsa-miR-107	CLIP-seq
MIRT2593546	hsa-miR-1251	CLIP-seq
MIRT2593548	hsa-miR-127-5p	CLIP-seq
MIRT2593549	hsa-miR-1324	CLIP-seq
MIRT2593552	hsa-miR-15a	CLIP-seq
MIRT2593553	hsa-miR-15b	CLIP-seq
MIRT2593554	hsa-miR-16	CLIP-seq
MIRT2593558	hsa-miR-195	CLIP-seq
MIRT2593564	hsa-miR-3166	CLIP-seq
MIRT2593568	hsa-miR-3619-3p	CLIP-seq
MIRT2593570	hsa-miR-3664-5p	CLIP-seq
MIRT2593571	hsa-miR-3682-5p	CLIP-seq
MIRT2593573	hsa-miR-369-3p	CLIP-seq
MIRT2593574	hsa-miR-371b-3p	CLIP-seq
MIRT2593575	hsa-miR-374a	CLIP-seq
MIRT2593576	hsa-miR-374b	CLIP-seq
MIRT2593579	hsa-miR-424	CLIP-seq
MIRT2593581	hsa-miR-4310	CLIP-seq
MIRT2593586	hsa-miR-4476	CLIP-seq
MIRT2593587	hsa-miR-4477b	CLIP-seq
MIRT2593589	hsa-miR-4522	CLIP-seq
MIRT2593590	hsa-miR-4533	CLIP-seq
MIRT2593594	hsa-miR-4659a-5p	CLIP-seq
MIRT2593595	hsa-miR-4659b-5p	CLIP-seq
MIRT2593598	hsa-miR-4700-3p	CLIP-seq
MIRT2593599	hsa-miR-4711-5p	CLIP-seq
MIRT2593603	hsa-miR-4729	CLIP-seq
MIRT2593605	hsa-miR-4749-3p	CLIP-seq
MIRT2593607	hsa-miR-4771	CLIP-seq
MIRT2593608	hsa-miR-4776-3p	CLIP-seq
MIRT2593609	hsa-miR-4777-5p	CLIP-seq
MIRT2593611	hsa-miR-497	CLIP-seq
MIRT2593612	hsa-miR-499a-5p	CLIP-seq
MIRT2593616	hsa-miR-548n	CLIP-seq
MIRT2593617	hsa-miR-556-3p	CLIP-seq
MIRT2593618	hsa-miR-570	CLIP-seq
MIRT2593623	hsa-miR-651	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16815647
GO:0005737	Component	Cytoplasm	IEA
GO:0006112	Process	Energy reserve metabolic process	IC	20165904
GO:0007005	Process	Mitochondrion organization	IMP	20165904
GO:0009891	Process	Positive regulation of biosynthetic process	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	20165904
GO:0010635	Process	Regulation of mitochondrial fusion	IC	20165904
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0044320	Process	Cellular response to leptin stimulus	IEA
GO:0045444	Process	Fat cell differentiation	IDA	16815647
GO:0045935	Process	Positive regulation of nucleobase-containing compound metabolic process	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20165904
GO:0046325	Process	Negative regulation of D-glucose import	IBA
GO:0046325	Process	Negative regulation of D-glucose import	IDA	19079291
GO:0046325	Process	Negative regulation of D-glucose import	IEA
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IDA	19079291
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	ISS
GO:0051881	Process	Regulation of mitochondrial membrane potential	TAS	20165904
GO:0070346	Process	Positive regulation of fat cell proliferation	IDA	16815647
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	ISS
GO:0071354	Process	Cellular response to interleukin-6	IEA
GO:0071354	Process	Cellular response to interleukin-6	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	NAS	20140872
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071398	Process	Cellular response to fatty acid	ISS
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IDA	19079291
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IBA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	ISS
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IMP	20165904
GO:2001169	Process	Regulation of ATP biosynthetic process	IEA
GO:2001170	Process	Negative regulation of ATP biosynthetic process	IMP	20165904
GO:2001171	Process	Positive regulation of ATP biosynthetic process	IEA
GO:2001171	Process	Positive regulation of ATP biosynthetic process	ISS

MIM	HGNC	e!Ensembl
612930	26084	ENSG00000153823

Q7Z2X4

Protein name

PTB-containing, cubilin and LRP1-interacting protein (P-CLI1) (Phosphotyrosine interaction domain-containing protein 1) (Protein NYGGF4)

Protein function

Increases proliferation of preadipocytes without affecting adipocytic differentiation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14719	PID_2	90 → 247	Phosphotyrosine interaction domain (PTB/PID)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in subcutaneous fat, heart, skeletal muscle, brain, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocyte. {ECO:0000269|PubMed:16815647}.

Sequence

MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGTHFQTMLKSKLNVLTLKK
EPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWK
KHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIF
AWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEE
VSQELESDDG

Sequence length

250

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Moyamoya angiopathy	Likely pathogenic	rs375488219	RCV004704484	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARPAL TUNNEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL NEOVASCULARIZATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PID1-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Medulloblastoma	Medulloblastoma	BEFREE	24300787, 28400607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	24300787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	28400607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	34341362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24300787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28400607		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	8732866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	8732866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	24300787, 28400607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24737086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24300787, 28400607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28400607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24300787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24300787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30904610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20010835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24300787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24300787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	8732866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	24300787, 28400607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24300787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23927930		★★★★★ ★☆☆☆☆ Found in Text Mining only

PID1 (phosphotyrosine interaction domain containing 1)