Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Other IDs Protein Associated diseases
Entrez ID	55001
Gene name	Tetratricopeptide repeat domain 22
Gene symbol	TTC22
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1p32.3
Summary	This gene encodes a protein with seven tetratricopeptide (TPR) repeats. Tetratricopeptide repeat containing motifs are found in a variety of proteins and may mediate protein-protein interactions and chaperone activity. Alternatively spliced transcript var

Show/Hide all (32)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052423	hsa-let-7a-5p	CLASH	23622248
MIRT528543	hsa-miR-6858-3p	PAR-CLIP	22012620
MIRT528542	hsa-miR-4676-5p	PAR-CLIP	22012620
MIRT528541	hsa-miR-575	PAR-CLIP	22012620
MIRT528540	hsa-miR-4650-5p	PAR-CLIP	22012620
MIRT528539	hsa-miR-4755-3p	PAR-CLIP	22012620
MIRT528538	hsa-miR-4662a-5p	PAR-CLIP	22012620
MIRT528543	hsa-miR-6858-3p	PAR-CLIP	22012620
MIRT528542	hsa-miR-4676-5p	PAR-CLIP	22012620
MIRT528541	hsa-miR-575	PAR-CLIP	22012620
MIRT528540	hsa-miR-4650-5p	PAR-CLIP	22012620
MIRT528539	hsa-miR-4755-3p	PAR-CLIP	22012620
MIRT528538	hsa-miR-4662a-5p	PAR-CLIP	22012620
MIRT1461059	hsa-miR-1827	CLIP-seq
MIRT1461060	hsa-miR-3612	CLIP-seq
MIRT1461061	hsa-miR-380	CLIP-seq
MIRT1461062	hsa-miR-4459	CLIP-seq
MIRT1461063	hsa-miR-4690-5p	CLIP-seq
MIRT1461064	hsa-miR-4695-5p	CLIP-seq
MIRT1461065	hsa-miR-4722-5p	CLIP-seq
MIRT1461066	hsa-miR-621	CLIP-seq
MIRT1461067	hsa-miR-650	CLIP-seq
MIRT2359406	hsa-miR-218	CLIP-seq
MIRT2359407	hsa-miR-3663-5p	CLIP-seq
MIRT2359408	hsa-miR-4318	CLIP-seq
MIRT2359409	hsa-miR-4663	CLIP-seq
MIRT2359410	hsa-miR-4693-5p	CLIP-seq
MIRT2359411	hsa-miR-4728-3p	CLIP-seq
MIRT2359412	hsa-miR-550b	CLIP-seq
MIRT2359413	hsa-miR-622	CLIP-seq
MIRT2359414	hsa-miR-636	CLIP-seq
MIRT2359415	hsa-miR-892a	CLIP-seq

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q5TAA0

Protein name

Tetratricopeptide repeat protein 22 (TPR repeat protein 22)

Family and domains

Sequence

MAELEAVADDLDALIDDLDYLPGHFHLEMQLNFEPRSPAPQRARDLKLQREGLRQELQLA
AAPQRPAVRHLLGAFAFYLEELDEARECFLEVAHEHPGNLNAWANLAHVYGRLGQEEEEE
ACAARLADLMGLAEEPEAAGDPQLRAARCLAEQGYAHGFDVGCASPEERARGLAAGIALY
DKALGYGQQIPMEEKRGWYFTMATLYIRLDGIFLELGSEEQKRLPAFNRTLALLRQVLKS
EDPRHRALAWCYLGMLLERKDTFSTTPMGVHDCGYSGTDPLDCFGKAIEIAKNQPPILNR
LAKIFYFLGKQDMAIGTCNMALDVLRDPELNWQAYCTRAKIHIRAYLHDLKRAKMGLGGM
PDRNHLACAKADLEEVVRVCPGFKAYLDIGQVYYYMGVDAVQELLAVDEAALNQALVFLA
KAGESELGATLPELQLLRGKCLRIKGEDANAAACFKRAVELDDAGSSHTDGFGCLLEALL
AQWSQAQLSDGELGREVDAWLRRAQDKYPAARLRQELQRVWRGHTDEVLGLARALVAQGR
PALVRLLFETMEREGEGASAPRDRRAVSF

Sequence length

569

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL ADENOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30664167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30664167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30664167		★★★★★ ★☆☆☆☆ Found in Text Mining only

TTC22 (tetratricopeptide repeat domain 22)