AURKAIP1 (aurora kinase A interacting protein 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 54998
Gene name Aurora kinase A interacting protein 1
Gene symbol AURKAIP1
Synonyms (NCBI Gene)
AIPAKIPMRP-S38mS38
Chromosome 1
Chromosome location 1p36.33
miRNA miRNA information provided by mirtarbase database.
4
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (4)
miRTarBase ID miRNA Experiments Reference
MIRT050107 hsa-miR-26a-5p CLASH 23622248
MIRT043432 hsa-miR-331-3p CLASH 23622248
MIRT441136 hsa-miR-218-5p HITS-CLIP 23212916
MIRT441136 hsa-miR-218-5p HITS-CLIP 23212916
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (17)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 12244051, 25416956, 32296183
GO:0005634 Component Nucleus IDA 12244051
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
609183 24114 ENSG00000175756
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NWT8
Protein name Small ribosomal subunit protein mS38 (28S ribosomal protein S38, mitochondrial) (MRP-S38) (Aurora kinase A-interacting protein) (AURKA-interacting protein)
Protein function May act as a negative regulator of Aurora-A kinase, by down-regulation through proteasome-dependent degradation.
PDB 3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08213 DUF1713 127 → 159 Mitochondrial domain of unknown function (DUF1713) Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed and especially highly expressed in heart, skeletal muscle and testis.
Sequence 
MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLEL
EEMLVPRKMSVSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVA
DAPQIQCKNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKA
GLKEAPEGWQTPKIYLRGK
Sequence length 199
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Mitochondrial translation elongation
Mitochondrial translation termination
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
OSTEOPOROSIS — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (157)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Abducens Nerve Palsy Abducens palsy HPO_DG
★★★★★
★☆☆☆☆
Found in Text Mining only
Abnormal fear/anxiety-related behavior Behavioral abnormality HPO_DG
★★★★★
★☆☆☆☆
Found in Text Mining only
Acanthosis Nigricans Acanthosis Nigricans HPO_DG
★★★★★
★☆☆☆☆
Found in Text Mining only
Acne Acne HPO_DG
★★★★★
★☆☆☆☆
Found in Text Mining only
Acromegaly Acromegaly Pubtator 17360484, 17893251, 23300914, 25019383, 25075136, 27253664, 27650164, 28634279, 36757586, 36843582, 40500813 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Acromegaly Acromegaly BEFREE 17916996, 18174729, 20595802, 21778740, 22319033, 23674160, 23743763, 24423289, 25019383, 25093619, 25184284, 26021842, 26815903, 26963951, 27033541
View all (6 more)
★★★★★
★☆☆☆☆
Found in Text Mining only
Acromegaly Acromegaly ORPHANET_DG 20530095, 20616502, 23038625, 23300914
★★★★★
★☆☆☆☆
Found in Text Mining only
Acromegaly Acromegaly Orphanet
★★★★★
★☆☆☆☆
Found in Text Mining only
ACTH-Secreting Pituitary Adenoma Pituitary adenoma BEFREE 17914118, 25184284
★★★★★
★☆☆☆☆
Found in Text Mining only
ACTH-Secreting Pituitary Adenoma Pituitary adenoma CTD_human_DG
★★★★★
★☆☆☆☆
Found in Text Mining only