Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	54984
Gene name	PIN2 (TERF1) interacting telomerase inhibitor 1
Gene symbol	PINX1
Synonyms (NCBI Gene)	Gno1LPTLLPTSPxr1
Chromosome	8
Chromosome location	8p23.1

105

Show/Hide all (105)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043552	hsa-miR-331-3p	CLASH	23622248
MIRT712989	hsa-miR-208a-5p	HITS-CLIP	19536157
MIRT712988	hsa-miR-208b-5p	HITS-CLIP	19536157
MIRT712987	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT712986	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT712985	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT712984	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT712983	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT712982	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT712981	hsa-miR-4279	HITS-CLIP	19536157
MIRT712980	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT712979	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT712978	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT617989	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT617989	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT712989	hsa-miR-208a-5p	HITS-CLIP	19536157
MIRT712988	hsa-miR-208b-5p	HITS-CLIP	19536157
MIRT712987	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT712986	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT712985	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT712984	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT712983	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT712982	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT712981	hsa-miR-4279	HITS-CLIP	19536157
MIRT712980	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT712979	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT712978	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT617989	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT617989	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT609797	hsa-miR-8485	HITS-CLIP	23824327
MIRT609796	hsa-miR-5683	HITS-CLIP	23824327
MIRT609795	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT609794	hsa-miR-642b-3p	HITS-CLIP	23824327

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000228	Component	Nuclear chromosome	IDA	19393617
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IDA	19393617
GO:0000776	Component	Kinetochore	IEA
GO:0000781	Component	Chromosome, telomeric region	IDA	11701125, 19265708, 21119197, 24415760
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005515	Function	Protein binding	IPI	11701125, 15044100, 15381700, 17389648, 18202258, 19265708, 19393617, 21044950, 21119197, 21900206, 24415760, 27214791, 28255170, 32296183, 33961781, 39251607
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	11701125, 19265708, 19393617, 21119197, 24415760
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	NAS	26194824
GO:0005739	Component	Mitochondrion	IDA
GO:0005819	Component	Spindle	IDA	19393617
GO:0007004	Process	Telomere maintenance via telomerase	IDA	11701125
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	19393617
GO:0008285	Process	Negative regulation of cell population proliferation	NAS	11003615
GO:0010521	Function	Telomerase inhibitor activity	IBA
GO:0010521	Function	Telomerase inhibitor activity	IDA	11701125, 24415760
GO:0010521	Function	Telomerase inhibitor activity	IMP	21119197
GO:0010521	Function	Telomerase inhibitor activity	NAS	26194824
GO:0010521	Function	Telomerase inhibitor activity	TAS	15381700
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	IDA	11701125
GO:0031397	Process	Negative regulation of protein ubiquitination	IMP	24415760
GO:0031647	Process	Regulation of protein stability	IMP	24415760
GO:0032211	Process	Negative regulation of telomere maintenance via telomerase	IDA	11701125
GO:0032211	Process	Negative regulation of telomere maintenance via telomerase	IMP	21119197
GO:0044877	Function	Protein-containing complex binding	IPI	18202258
GO:0070034	Function	Telomerase RNA binding	IDA	15381700
GO:0070198	Process	Protein localization to chromosome, telomeric region	IMP	22749911
GO:1902570	Process	Protein localization to nucleolus	IDA	24415760
GO:1904357	Process	Negative regulation of telomere maintenance via telomere lengthening	NAS	26194824
GO:1904751	Process	Positive regulation of protein localization to nucleolus	IDA	19265708

MIM	HGNC	e!Ensembl
606505	30046	ENSG00000254093

Q96BK5

Protein name

PIN2/TERF1-interacting telomerase inhibitor 1 (Liver-related putative tumor suppressor) (Pin2-interacting protein X1) (Protein 67-11-3) (TRF1-interacting protein 1)

Protein function

Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor sup

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01585	G-patch	26 → 70	G-patch domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous; expressed at low levels. Not detectable in a number of hepatocarcinoma cell lines.

Sequence

MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQV
KNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKIS
KNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQE
YFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQPKAKRHTEGKP
ERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKK
KLQKPVEIAEDATLEETLVKKKKKKDSK

Sequence length

328

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC BRONCHITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL LIPOPROTEIN LIPASE DEFICIENCY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE REPRODUCTIVE ORGAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITRAL VALVE PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (68)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne Vulgaris	Acne	GWASCAT_DG	30542056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	31058951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29305433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	GWASDB_DG	21909108		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	GWASCAT_DG	21909108		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30026037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21436583, 24672800, 25888829, 26187699, 28586040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22527105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24672800, 28586040	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	21102426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24672800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21436583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12508358, 27221889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30026037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25374231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	28693215		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29017500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29017500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24839934, 26211574, 30015978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31254127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30054458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23912465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25698538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26261583	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	21056083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	27221889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	15264240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11003615, 11867205, 12439923, 12508358, 15375513, 27221889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12439923, 12508358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	24020493, 27221889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	27221889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	24020493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12439923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29305433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25374231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34337078	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34337078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21436583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21436583, 24672800, 25888829, 26187699, 28586040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31254127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	12508358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25374231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15264240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15637589, 18784941, 20544396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30026037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19117989, 21436580, 21436583, 22021332, 22316341, 24268029, 25479038, 25698538, 27556185, 28978030, 29017500, 30015978, 30138944, 31254127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29017500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29017500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	14750185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22316341, 30138944, 31027734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22316341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15375513, 15637589, 18784941, 19117989, 21436580, 21436583, 22021332, 22316341, 24268029, 24672800, 25479038, 26211574, 27556185, 28372542, 28815183 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	14750185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28372542, 28815183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30026037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peroxisome biogenesis disorders	Zellweger Syndrome	BEFREE	7719337, 8993569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	21056083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	15264240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15264240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31254127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31254127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23341363, 25045845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23341363, 23912465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15637589, 18784941, 20544396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15637589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	24268029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22363464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	24268029		★★★★★ ★☆☆☆☆ Found in Text Mining only

PINX1 (PIN2 (TERF1) interacting telomerase inhibitor 1)