PLAAT2 (phospholipase A and acyltransferase 2)

Gene

• Entrez ID: 54979
• Gene name: Phospholipase A and acyltransferase 2
• Gene symbol: PLAAT2
• Synonyms (NCBI Gene): HRASLS2, PLA1/2-2, PLAAT-2
• Chromosome: 11
• Chromosome location: 11q12.3
• Summary: The protein encoded by this gene has both phospholipase and acyltransferase activities and acts as a tumor suppressor. The encoded protein can hydrolyze dipalmitoylated phosphatidylcholine (PC) to palmitic acid and lyso-PC. In addition, this protein can c

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004623	Function	Phospholipase A2 activity	IBA
GO:0004623	Function	Phospholipase A2 activity	IDA	22825852
GO:0004623	Function	Phospholipase A2 activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008970	Function	Phospholipase A1 activity	IBA
GO:0008970	Function	Phospholipase A1 activity	IDA	22825852
GO:0008970	Function	Phospholipase A1 activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016410	Function	N-acyltransferase activity	IBA
GO:0016410	Function	N-acyltransferase activity	IDA	22825852
GO:0016410	Function	N-acyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016746	Function	Acyltransferase activity	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0036152	Process	Phosphatidylethanolamine acyl-chain remodeling	TAS
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IBA
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IDA	22825852
GO:0070292	Process	N-acylphosphatidylethanolamine metabolic process	IEA

Other IDs

• MIM: 613866
• HGNC: 17824
• e!Ensembl: ENSG00000133328

Protein

• UniProt ID: Q9NWW9
• Protein name: Phospholipase A and acyltransferase 2 (EC 2.3.1.-) (EC 3.1.1.32) (EC 3.1.1.4) (HRAS-like suppressor 2)
• Protein function: Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed:19615464, PubMed:22605381, PubMed:22825852, PubMed:26503625). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids
• PDB: 4DPZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04970	LRAT	6 → 126	Lecithin retinol acyltransferase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in liver, kidney, small intestine testis and colon (PubMed:19615464). Undetectable in testis, placenta, salivary gland and fetal brain (PubMed:18163183). {ECO:0000269|PubMed:18163183, ECO:0000269|PubMed:19615464}.
• Sequence:

  MALARPRPRLGDLIEISRFGYAHWAIYVGDGYVVHLAPASEIAGAGAASVLSALTNKAIV
  KKELLSVVAGGDNYRVNNKHDDRYTPLPSNKIVKRAEELVGQELPYSLTSDNCEHFVNHL
  RYGVSRSDQVTGAVTTVGVAAGLLAAASLVGILLARSKRERQ

• Sequence length: 162

Pathways

KEGG:

Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Regulation of lipolysis in adipocytes

Reactome:

Acyl chain remodelling of PE

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Obesity	Obesity	BEFREE	31203417		★☆☆☆☆ Found in Text Mining only