Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54971
Gene name	BTG3 associated nuclear protein
Gene symbol	BANP
Synonyms (NCBI Gene)	BEND1SMAR1SMARBP1
Chromosome	16
Chromosome location	16q24.2
Summary	This gene encodes a protein that binds to matrix attachment regions. The protein forms a complex with p53 and negatively regulates p53 transcription, and functions as a tumor suppressor and cell cycle regulator. Multiple transcript variants encoding diffe

191

Show/Hide all (191)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438652	hsa-miR-320a	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	23876508
MIRT438652	hsa-miR-320a	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	23876508
MIRT438652	hsa-miR-320a	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	23876508
MIRT438652	hsa-miR-320a	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	23876508
MIRT487490	hsa-miR-6085	PAR-CLIP	20371350
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT487487	hsa-miR-4285	PAR-CLIP	20371350
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT487485	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT487484	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT487483	hsa-miR-4283	PAR-CLIP	20371350
MIRT487490	hsa-miR-6085	PAR-CLIP	20371350
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT487487	hsa-miR-4285	PAR-CLIP	20371350
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT487485	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT487484	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT487483	hsa-miR-4283	PAR-CLIP	20371350
MIRT527624	hsa-miR-888-5p	PAR-CLIP	22012620
MIRT527623	hsa-miR-6165	PAR-CLIP	22012620
MIRT527622	hsa-miR-214-3p	PAR-CLIP	22012620
MIRT527620	hsa-miR-3619-5p	PAR-CLIP	22012620
MIRT527621	hsa-miR-761	PAR-CLIP	22012620
MIRT527619	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT527618	hsa-miR-5681a	PAR-CLIP	22012620
MIRT527617	hsa-miR-1286	PAR-CLIP	22012620
MIRT487490	hsa-miR-6085	PAR-CLIP	23592263
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	23592263
MIRT487487	hsa-miR-4285	PAR-CLIP	23592263
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT487485	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT487484	hsa-miR-25-5p	PAR-CLIP	23592263
MIRT487483	hsa-miR-4283	PAR-CLIP	23592263
MIRT487484	hsa-miR-25-5p	PAR-CLIP	26701625
MIRT487484	hsa-miR-25-5p	PAR-CLIP	26701625
MIRT487484	hsa-miR-25-5p	PAR-CLIP	26701625
MIRT487484	hsa-miR-25-5p	PAR-CLIP	26701625
MIRT487484	hsa-miR-25-5p	PAR-CLIP	26701625
MIRT487484	hsa-miR-25-5p	PAR-CLIP	26701625
MIRT487484	hsa-miR-25-5p	PAR-CLIP	26701625
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT487485	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT487485	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT487485	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT487485	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT487485	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT487485	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT487485	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT487483	hsa-miR-4283	PAR-CLIP	26701625
MIRT487483	hsa-miR-4283	PAR-CLIP	26701625
MIRT487483	hsa-miR-4283	PAR-CLIP	26701625
MIRT487483	hsa-miR-4283	PAR-CLIP	26701625
MIRT487483	hsa-miR-4283	PAR-CLIP	26701625
MIRT487483	hsa-miR-4283	PAR-CLIP	26701625
MIRT487483	hsa-miR-4283	PAR-CLIP	26701625
MIRT487487	hsa-miR-4285	PAR-CLIP	26701625
MIRT487487	hsa-miR-4285	PAR-CLIP	26701625
MIRT487487	hsa-miR-4285	PAR-CLIP	26701625
MIRT487487	hsa-miR-4285	PAR-CLIP	26701625
MIRT487487	hsa-miR-4285	PAR-CLIP	26701625
MIRT487487	hsa-miR-4285	PAR-CLIP	26701625
MIRT487487	hsa-miR-4285	PAR-CLIP	26701625
MIRT487490	hsa-miR-6085	PAR-CLIP	26701625
MIRT487490	hsa-miR-6085	PAR-CLIP	26701625
MIRT487490	hsa-miR-6085	PAR-CLIP	26701625
MIRT487490	hsa-miR-6085	PAR-CLIP	26701625
MIRT487490	hsa-miR-6085	PAR-CLIP	26701625
MIRT487490	hsa-miR-6085	PAR-CLIP	26701625
MIRT487490	hsa-miR-6085	PAR-CLIP	26701625
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	26701625
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	26701625
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	26701625
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	26701625
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	26701625
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	26701625
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	26701625
MIRT487490	hsa-miR-6085	PAR-CLIP	20371350
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT487487	hsa-miR-4285	PAR-CLIP	20371350
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT487485	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT487484	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT487483	hsa-miR-4283	PAR-CLIP	20371350
MIRT487490	hsa-miR-6085	PAR-CLIP	20371350
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	20371350
MIRT487487	hsa-miR-4285	PAR-CLIP	20371350
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT487485	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT487484	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT487483	hsa-miR-4283	PAR-CLIP	20371350
MIRT527624	hsa-miR-888-5p	PAR-CLIP	22012620
MIRT527623	hsa-miR-6165	PAR-CLIP	22012620
MIRT527622	hsa-miR-214-3p	PAR-CLIP	22012620
MIRT527620	hsa-miR-3619-5p	PAR-CLIP	22012620
MIRT527621	hsa-miR-761	PAR-CLIP	22012620
MIRT527619	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT527618	hsa-miR-5681a	PAR-CLIP	22012620
MIRT527617	hsa-miR-1286	PAR-CLIP	22012620
MIRT487490	hsa-miR-6085	PAR-CLIP	23592263
MIRT487488	hsa-miR-6813-5p	PAR-CLIP	23592263
MIRT487487	hsa-miR-4285	PAR-CLIP	23592263
MIRT487486	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT487485	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT487484	hsa-miR-25-5p	PAR-CLIP	23592263
MIRT487483	hsa-miR-4283	PAR-CLIP	23592263
MIRT815805	hsa-miR-129-5p	CLIP-seq
MIRT815806	hsa-miR-3180	CLIP-seq
MIRT815807	hsa-miR-3180-3p	CLIP-seq
MIRT815808	hsa-miR-3196	CLIP-seq
MIRT815809	hsa-miR-340	CLIP-seq
MIRT815810	hsa-miR-3960	CLIP-seq
MIRT815811	hsa-miR-4467	CLIP-seq
MIRT815812	hsa-miR-4488	CLIP-seq
MIRT815813	hsa-miR-4505	CLIP-seq
MIRT815814	hsa-miR-4697-5p	CLIP-seq
MIRT815815	hsa-miR-4731-5p	CLIP-seq
MIRT815816	hsa-miR-637	CLIP-seq
MIRT815817	hsa-miR-1247	CLIP-seq
MIRT815818	hsa-miR-3117-5p	CLIP-seq
MIRT815819	hsa-miR-3120-3p	CLIP-seq
MIRT815820	hsa-miR-3654	CLIP-seq
MIRT815821	hsa-miR-425	CLIP-seq
MIRT815822	hsa-miR-4520a-3p	CLIP-seq
MIRT815823	hsa-miR-4638-3p	CLIP-seq
MIRT815824	hsa-miR-545	CLIP-seq
MIRT1941320	hsa-miR-214	CLIP-seq
MIRT1941320	hsa-miR-214	CLIP-seq
MIRT815818	hsa-miR-3117-5p	CLIP-seq
MIRT815819	hsa-miR-3120-3p	CLIP-seq
MIRT815820	hsa-miR-3654	CLIP-seq
MIRT2180084	hsa-miR-371-5p	CLIP-seq
MIRT815822	hsa-miR-4520a-3p	CLIP-seq
MIRT815823	hsa-miR-4638-3p	CLIP-seq
MIRT815824	hsa-miR-545	CLIP-seq
MIRT2180085	hsa-miR-888	CLIP-seq
MIRT815817	hsa-miR-1247	CLIP-seq
MIRT2483467	hsa-miR-1265	CLIP-seq
MIRT2483468	hsa-miR-1827	CLIP-seq
MIRT2483469	hsa-miR-1976	CLIP-seq
MIRT2483470	hsa-miR-2392	CLIP-seq
MIRT815818	hsa-miR-3117-5p	CLIP-seq
MIRT815819	hsa-miR-3120-3p	CLIP-seq
MIRT815806	hsa-miR-3180	CLIP-seq
MIRT815807	hsa-miR-3180-3p	CLIP-seq
MIRT815808	hsa-miR-3196	CLIP-seq
MIRT2483471	hsa-miR-331-3p	CLIP-seq
MIRT2483472	hsa-miR-3612	CLIP-seq
MIRT815820	hsa-miR-3654	CLIP-seq
MIRT2483473	hsa-miR-370	CLIP-seq
MIRT2483474	hsa-miR-3936	CLIP-seq
MIRT815810	hsa-miR-3960	CLIP-seq
MIRT815821	hsa-miR-425	CLIP-seq
MIRT2483475	hsa-miR-4292	CLIP-seq
MIRT815811	hsa-miR-4467	CLIP-seq
MIRT815812	hsa-miR-4488	CLIP-seq
MIRT815813	hsa-miR-4505	CLIP-seq
MIRT815822	hsa-miR-4520a-3p	CLIP-seq
MIRT815823	hsa-miR-4638-3p	CLIP-seq
MIRT815814	hsa-miR-4697-5p	CLIP-seq
MIRT815815	hsa-miR-4731-5p	CLIP-seq
MIRT815824	hsa-miR-545	CLIP-seq
MIRT815816	hsa-miR-637	CLIP-seq
MIRT2483476	hsa-miR-650	CLIP-seq
MIRT2483477	hsa-miR-658	CLIP-seq
MIRT2483478	hsa-miR-885-3p	CLIP-seq
MIRT815817	hsa-miR-1247	CLIP-seq
MIRT2483469	hsa-miR-1976	CLIP-seq
MIRT815818	hsa-miR-3117-5p	CLIP-seq
MIRT815819	hsa-miR-3120-3p	CLIP-seq
MIRT815806	hsa-miR-3180	CLIP-seq
MIRT815807	hsa-miR-3180-3p	CLIP-seq
MIRT815808	hsa-miR-3196	CLIP-seq
MIRT815820	hsa-miR-3654	CLIP-seq
MIRT2483473	hsa-miR-370	CLIP-seq
MIRT2483474	hsa-miR-3936	CLIP-seq
MIRT815810	hsa-miR-3960	CLIP-seq
MIRT815811	hsa-miR-4467	CLIP-seq
MIRT815812	hsa-miR-4488	CLIP-seq
MIRT815813	hsa-miR-4505	CLIP-seq
MIRT815822	hsa-miR-4520a-3p	CLIP-seq
MIRT815823	hsa-miR-4638-3p	CLIP-seq
MIRT815814	hsa-miR-4697-5p	CLIP-seq
MIRT815815	hsa-miR-4731-5p	CLIP-seq
MIRT815824	hsa-miR-545	CLIP-seq
MIRT815816	hsa-miR-637	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 20075864, 21516116, 24722188, 25416956, 25910212, 26871637, 28514442, 31515488, 32296183, 32814053, 33961781, 38169650
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016607	Component	Nuclear speck	IEA
GO:0042802	Function	Identical protein binding	IPI	26871637, 32296183

MIM	HGNC	e!Ensembl
611564	13450	ENSG00000172530

Q8N9N5

Protein name

Protein BANP (BEN domain-containing protein 1) (Btg3-associated nuclear protein) (Scaffold/matrix-associated region-1-binding protein)

Protein function

Controls V(D)J recombination during T-cell development by repressing T-cell receptor (TCR) beta enhancer function (By similarity). Binds to scaffold/matrix attachment region beta (S/MARbeta), an ATC-rich DNA sequence located upstream of the TCR

PDB

7YUG , 7YUK , 8HTX , 8YZT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10523	BEN	250 → 319	BEN domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Down-regulated in breast cancer cell lines. {ECO:0000269|PubMed:16166625}.

Sequence

MMSEHDLADVVQIAVEDLSPDHPVVLENHVVTDEDEPALKRQRLEINCQDPSIKTICLRL
DSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLGATQTCNKVRCVVPQTTV
ILNNDRQNAIVAKMEDPLSNRAPDSLENVISNAVPGRRQNTIVVKVPGQEDSHHEDGESG
SEASDSVSSCGQAGSQSIGSNVTLITLNSEEDYPNGTWLGDENNPEMRVRCAIIPSDMLH
ISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCHLFYKFGIT
ESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPNSSSYCPSEPMMSTPPPASELP
QPQPQPQALHYALANAQQVQIHQIGEDGQVQVGHLHIAQVPQGEQVQITQDSEGNLQIHH
VGQDGQLLEATRIPCLLAPSVFKASSGQVLQGAQLIAVASSDPAAAGVDGSPLQGSDIQV
QYVQLAPVSDHTAGAQTAEALQPTLQPEMQLEHGAIQIQ

Sequence length

519

Interactions

View interactions

	Reactome
			Regulation of TP53 Activity through Association with Co-factors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ependymoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26609032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17668048, 17726044, 18822384, 20709157, 25086032, 25239884, 26629941, 28617439, 30301506, 31422285		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	16166625, 17668048, 17726044, 20153327, 25086032, 26080397, 26325577, 26629941, 28617439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29969631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26609032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28103507, 29765542, 29969631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34689394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	24265017, 25675348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	26040312, 38267912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17668048, 17726044, 18822384, 20153327, 20709157, 25086032, 25239884, 26629941, 28617439, 30301506, 31422285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29969631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17668048, 17726044, 18822384, 20709157, 28617439, 29969631, 31422285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29338617		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12494467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	GWASCAT_DG	29538362		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	GWASCAT_DG	29538362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12494467, 18822384, 20153327, 25086032, 25239884, 26629941, 28232831, 28617439, 30301506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26609032		★★★★★ ★☆☆☆☆ Found in Text Mining only

BANP (BTG3 associated nuclear protein)