Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54963
Gene name	Uridine-cytidine kinase 1 like 1
Gene symbol	UCKL1
Synonyms (NCBI Gene)	UCK1LURKL1
Chromosome	20
Chromosome location	20q13.33
Summary	The protein encoded by this gene is a uridine kinase. Uridine kinases catalyze the phosphorylation of uridine to uridine monophosphate. This protein has been shown to bind to Epstein-Barr nuclear antigen 3 as well as natural killer lytic-associated molecu

Show/Hide all (34)

miRTarBase ID	miRNA	Experiments
MIRT1472695	hsa-miR-1293	CLIP-seq
MIRT1472696	hsa-miR-1827	CLIP-seq
MIRT1472697	hsa-miR-3612	CLIP-seq
MIRT1472698	hsa-miR-4433	CLIP-seq
MIRT1472699	hsa-miR-4459	CLIP-seq
MIRT1472700	hsa-miR-4483	CLIP-seq
MIRT1472701	hsa-miR-4695-5p	CLIP-seq
MIRT1472702	hsa-miR-4722-5p	CLIP-seq
MIRT1472703	hsa-miR-4768-3p	CLIP-seq
MIRT1472704	hsa-miR-4779	CLIP-seq
MIRT1472705	hsa-miR-541	CLIP-seq
MIRT1472706	hsa-miR-650	CLIP-seq
MIRT1472707	hsa-miR-654-5p	CLIP-seq
MIRT1472708	hsa-miR-765	CLIP-seq
MIRT1472709	hsa-miR-940	CLIP-seq
MIRT1472695	hsa-miR-1293	CLIP-seq
MIRT1472696	hsa-miR-1827	CLIP-seq
MIRT2362874	hsa-miR-3144-5p	CLIP-seq
MIRT2362875	hsa-miR-3191	CLIP-seq
MIRT1472697	hsa-miR-3612	CLIP-seq
MIRT1472698	hsa-miR-4433	CLIP-seq
MIRT1472699	hsa-miR-4459	CLIP-seq
MIRT1472700	hsa-miR-4483	CLIP-seq
MIRT2362876	hsa-miR-4652-5p	CLIP-seq
MIRT1472701	hsa-miR-4695-5p	CLIP-seq
MIRT1472702	hsa-miR-4722-5p	CLIP-seq
MIRT1472703	hsa-miR-4768-3p	CLIP-seq
MIRT1472704	hsa-miR-4779	CLIP-seq
MIRT2362877	hsa-miR-491-5p	CLIP-seq
MIRT1472705	hsa-miR-541	CLIP-seq
MIRT1472706	hsa-miR-650	CLIP-seq
MIRT1472707	hsa-miR-654-5p	CLIP-seq
MIRT1472708	hsa-miR-765	CLIP-seq
MIRT1472709	hsa-miR-940	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004849	Function	Uridine kinase activity	IBA
GO:0004849	Function	Uridine kinase activity	IEA
GO:0004849	Function	Uridine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	12199906, 16709802
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0008655	Process	Pyrimidine-containing compound salvage	IEA
GO:0009224	Process	CMP biosynthetic process	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0034654	Process	Nucleobase-containing compound biosynthetic process	IEA
GO:0043097	Process	Pyrimidine nucleoside salvage	TAS
GO:0043771	Function	Cytidine kinase activity	IEA
GO:0044206	Process	UMP salvage	IEA
GO:0044211	Process	CTP salvage	IEA
GO:0055086	Process	Nucleobase-containing small molecule metabolic process	IEA
GO:1901137	Process	Carbohydrate derivative biosynthetic process	IEA

MIM	HGNC	e!Ensembl
610866	15938	ENSG00000198276

Q9NWZ5

Protein name

Uridine-cytidine kinase-like 1 (EC 2.7.1.48)

Protein function

May contribute to UTP accumulation needed for blast transformation and proliferation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00485	PRK	100 → 288	Phosphoribulokinase / Uridine kinase family	Domain
PF14681	UPRTase	326 → 532		Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12199906}.

Sequence

MAAPPARADADPSPTSPPTARDTPGRQAEKSETACEDRSNAESLDRLLPPVGTGRSPRKR
TTSQCKSEPPLLRTSKRTIYTAGRPPWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIE
ALDVPWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKV
PIYDFTTHSRKKDWKTLYGANVIIFEGIMAFADKTLLELLDMKIFVDTDSDIRLVRRLRR
DISERGRDIEGVIKQYNKFVKPSFDQYIQPTMRLADIVVPRGSGNTVAIDLIVQHVHSQL
EERELSVRAALASAHQCHPLPRTLSVLKSTPQVRGMHTIIRDKETSRDEFIFYSKRLMRL
LIEHALSFLPFQDCVVQTPQGQDYAGKCYAGKQITGVSILRAGETMEPALRAVCKDVRIG
TILIQTNQLTGEPELHYLRLPKDISDDHVILMDCTVSTGAAAMMAVRVLLDHDVPEDKIF
LLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLFRIIPGIGNFGDRYFGTDAVPDGSD
EEEVAYTG

Sequence length

548

Interactions

View interactions

	KEGG		Reactome
	Pyrimidine metabolism Drug metabolism - other enzymes Metabolic pathways Nucleotide metabolism		Pyrimidine salvage

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	19653100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30304569, 30344298	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29104783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19653100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25491628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

UCKL1 (uridine-cytidine kinase 1 like 1)