Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	54949
Gene name	Succinate dehydrogenase complex assembly factor 2
Gene symbol	SDHAF2
Synonyms (NCBI Gene)	C11orf79PGL2PPGL2SDH5hSDH5
Chromosome	11
Chromosome location	11q12.2
Summary	This gene encodes a mitochondrial protein needed for the flavination of a succinate dehydrogenase complex subunit required for activity of the complex. Mutations in this gene are associated with paraganglioma.[provided by RefSeq, Jul 2010]

Show/Hide all (12)

SNP ID	Visualize variation	Clinical significance	Consequence
rs113560320	G>A	Pathogenic	Missense variant, coding sequence variant
rs375280597	A>G	Uncertain-significance, likely-pathogenic	Splice acceptor variant
rs745989557	A>G,T	Likely-pathogenic	Splice acceptor variant
rs749527870	G>A	Likely-pathogenic	Splice donor variant
rs750979204	T>A,C	Likely-pathogenic	Stop gained, synonymous variant, coding sequence variant
rs753554501	->A	Pathogenic, likely-pathogenic	Frameshift variant, coding sequence variant
rs761956866	G>C,T	Likely-pathogenic	Splice acceptor variant
rs774508076	G>A	Uncertain-significance, likely-pathogenic, pathogenic	Coding sequence variant, stop gained
rs876658350	G>A	Uncertain-significance, likely-pathogenic	Stop gained, coding sequence variant
rs1554984631	->T	Pathogenic	Coding sequence variant, stop gained
rs1590764868	->AGCCC	Pathogenic	Coding sequence variant, frameshift variant
rs1590764905	G>A	Likely-pathogenic	Coding sequence variant, missense variant

203

Show/Hide all (203)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031763	hsa-miR-16-5p	Proteomics	18668040
MIRT720579	hsa-miR-5586-5p	HITS-CLIP	19536157
MIRT720578	hsa-miR-425-5p	HITS-CLIP	19536157
MIRT720577	hsa-miR-4530	HITS-CLIP	19536157
MIRT720576	hsa-miR-338-3p	HITS-CLIP	19536157
MIRT720575	hsa-miR-3192-5p	HITS-CLIP	19536157
MIRT720574	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT720573	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT720572	hsa-miR-661	HITS-CLIP	19536157
MIRT642764	hsa-miR-449b-3p	HITS-CLIP	23824327
MIRT642763	hsa-miR-382-3p	HITS-CLIP	23824327
MIRT642762	hsa-miR-3183	HITS-CLIP	23824327
MIRT642761	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT642759	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT642760	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT642758	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT642757	hsa-miR-8078	HITS-CLIP	23824327
MIRT642755	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT642756	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT642754	hsa-miR-1287-3p	HITS-CLIP	23824327
MIRT642753	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT720579	hsa-miR-5586-5p	HITS-CLIP	19536157
MIRT720578	hsa-miR-425-5p	HITS-CLIP	19536157
MIRT720577	hsa-miR-4530	HITS-CLIP	19536157
MIRT720576	hsa-miR-338-3p	HITS-CLIP	19536157
MIRT720575	hsa-miR-3192-5p	HITS-CLIP	19536157
MIRT720574	hsa-miR-642a-3p	HITS-CLIP	19536157
MIRT720573	hsa-miR-642b-3p	HITS-CLIP	19536157
MIRT720572	hsa-miR-661	HITS-CLIP	19536157
MIRT642764	hsa-miR-449b-3p	HITS-CLIP	23824327
MIRT642763	hsa-miR-382-3p	HITS-CLIP	23824327
MIRT642762	hsa-miR-3183	HITS-CLIP	23824327
MIRT642761	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT642759	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT642760	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT642758	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT642757	hsa-miR-8078	HITS-CLIP	23824327
MIRT642755	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT642756	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT642754	hsa-miR-1287-3p	HITS-CLIP	23824327
MIRT642753	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT1331786	hsa-miR-1204	CLIP-seq
MIRT1331787	hsa-miR-1285	CLIP-seq
MIRT1331788	hsa-miR-1286	CLIP-seq
MIRT1331789	hsa-miR-1304	CLIP-seq
MIRT1331790	hsa-miR-1827	CLIP-seq
MIRT1331791	hsa-miR-23a	CLIP-seq
MIRT1331792	hsa-miR-23b	CLIP-seq
MIRT1331793	hsa-miR-23c	CLIP-seq
MIRT1331794	hsa-miR-24	CLIP-seq
MIRT1331795	hsa-miR-2467-5p	CLIP-seq
MIRT1331796	hsa-miR-297	CLIP-seq
MIRT1331797	hsa-miR-3152-5p	CLIP-seq
MIRT1331798	hsa-miR-3160-3p	CLIP-seq
MIRT1331799	hsa-miR-3187-5p	CLIP-seq
MIRT1331800	hsa-miR-34b	CLIP-seq
MIRT1331801	hsa-miR-3545-5p	CLIP-seq
MIRT1331802	hsa-miR-3613-3p	CLIP-seq
MIRT1331803	hsa-miR-3614-5p	CLIP-seq
MIRT1331804	hsa-miR-3653	CLIP-seq
MIRT1331805	hsa-miR-3945	CLIP-seq
MIRT1331806	hsa-miR-3975	CLIP-seq
MIRT1331807	hsa-miR-4253	CLIP-seq
MIRT1331808	hsa-miR-4289	CLIP-seq
MIRT1331809	hsa-miR-4436b-3p	CLIP-seq
MIRT1331810	hsa-miR-4527	CLIP-seq
MIRT1331811	hsa-miR-4666-5p	CLIP-seq
MIRT1331812	hsa-miR-4708-3p	CLIP-seq
MIRT1331813	hsa-miR-4712-3p	CLIP-seq
MIRT1331814	hsa-miR-4761-3p	CLIP-seq
MIRT1331815	hsa-miR-4771	CLIP-seq
MIRT1331816	hsa-miR-485-5p	CLIP-seq
MIRT1331817	hsa-miR-499a-5p	CLIP-seq
MIRT1331818	hsa-miR-513a-3p	CLIP-seq
MIRT1331819	hsa-miR-518d-5p	CLIP-seq
MIRT1331820	hsa-miR-519b-5p	CLIP-seq
MIRT1331821	hsa-miR-519c-5p	CLIP-seq
MIRT1331822	hsa-miR-520c-5p	CLIP-seq
MIRT1331823	hsa-miR-526a	CLIP-seq
MIRT1331824	hsa-miR-548l	CLIP-seq
MIRT1331825	hsa-miR-548n	CLIP-seq
MIRT1331826	hsa-miR-562	CLIP-seq
MIRT1331827	hsa-miR-567	CLIP-seq
MIRT1331828	hsa-miR-580	CLIP-seq
MIRT1331829	hsa-miR-612	CLIP-seq
MIRT1331830	hsa-miR-676	CLIP-seq
MIRT1331831	hsa-miR-940	CLIP-seq
MIRT1331789	hsa-miR-1304	CLIP-seq
MIRT1331790	hsa-miR-1827	CLIP-seq
MIRT1331803	hsa-miR-3614-5p	CLIP-seq
MIRT1331831	hsa-miR-940	CLIP-seq
MIRT2098047	hsa-miR-1202	CLIP-seq
MIRT2098048	hsa-miR-3194-5p	CLIP-seq
MIRT2098049	hsa-miR-3972	CLIP-seq
MIRT2098050	hsa-miR-4738-5p	CLIP-seq
MIRT2098051	hsa-miR-628-5p	CLIP-seq
MIRT1331786	hsa-miR-1204	CLIP-seq
MIRT2322718	hsa-miR-1244	CLIP-seq
MIRT1331788	hsa-miR-1286	CLIP-seq
MIRT1331789	hsa-miR-1304	CLIP-seq
MIRT2322719	hsa-miR-1587	CLIP-seq
MIRT1331790	hsa-miR-1827	CLIP-seq
MIRT2322720	hsa-miR-1911	CLIP-seq
MIRT1331791	hsa-miR-23a	CLIP-seq
MIRT1331792	hsa-miR-23b	CLIP-seq
MIRT1331793	hsa-miR-23c	CLIP-seq
MIRT1331794	hsa-miR-24	CLIP-seq
MIRT1331795	hsa-miR-2467-5p	CLIP-seq
MIRT1331796	hsa-miR-297	CLIP-seq
MIRT1331798	hsa-miR-3160-3p	CLIP-seq
MIRT1331800	hsa-miR-34b	CLIP-seq
MIRT1331801	hsa-miR-3545-5p	CLIP-seq
MIRT1331802	hsa-miR-3613-3p	CLIP-seq
MIRT1331803	hsa-miR-3614-5p	CLIP-seq
MIRT2322721	hsa-miR-371b-3p	CLIP-seq
MIRT1331806	hsa-miR-3975	CLIP-seq
MIRT1331808	hsa-miR-4289	CLIP-seq
MIRT2322722	hsa-miR-4290	CLIP-seq
MIRT2322723	hsa-miR-4492	CLIP-seq
MIRT2322724	hsa-miR-4494	CLIP-seq
MIRT2322725	hsa-miR-4498	CLIP-seq
MIRT2322726	hsa-miR-4499	CLIP-seq
MIRT2322727	hsa-miR-4649-3p	CLIP-seq
MIRT2322728	hsa-miR-4656	CLIP-seq
MIRT1331811	hsa-miR-4666-5p	CLIP-seq
MIRT2322729	hsa-miR-4674	CLIP-seq
MIRT2322730	hsa-miR-4675	CLIP-seq
MIRT2322731	hsa-miR-4699-5p	CLIP-seq
MIRT1331813	hsa-miR-4712-3p	CLIP-seq
MIRT2322732	hsa-miR-4724-5p	CLIP-seq
MIRT2322733	hsa-miR-4741	CLIP-seq
MIRT1331815	hsa-miR-4771	CLIP-seq
MIRT1331816	hsa-miR-485-5p	CLIP-seq
MIRT1331817	hsa-miR-499a-5p	CLIP-seq
MIRT1331824	hsa-miR-548l	CLIP-seq
MIRT1331825	hsa-miR-548n	CLIP-seq
MIRT1331826	hsa-miR-562	CLIP-seq
MIRT1331827	hsa-miR-567	CLIP-seq
MIRT1331828	hsa-miR-580	CLIP-seq
MIRT2322734	hsa-miR-635	CLIP-seq
MIRT1331830	hsa-miR-676	CLIP-seq
MIRT2322735	hsa-miR-762	CLIP-seq
MIRT1331831	hsa-miR-940	CLIP-seq
MIRT1331788	hsa-miR-1286	CLIP-seq
MIRT1331789	hsa-miR-1304	CLIP-seq
MIRT1331790	hsa-miR-1827	CLIP-seq
MIRT1331791	hsa-miR-23a	CLIP-seq
MIRT1331792	hsa-miR-23b	CLIP-seq
MIRT1331793	hsa-miR-23c	CLIP-seq
MIRT1331794	hsa-miR-24	CLIP-seq
MIRT1331795	hsa-miR-2467-5p	CLIP-seq
MIRT1331796	hsa-miR-297	CLIP-seq
MIRT1331798	hsa-miR-3160-3p	CLIP-seq
MIRT1331800	hsa-miR-34b	CLIP-seq
MIRT1331801	hsa-miR-3545-5p	CLIP-seq
MIRT1331802	hsa-miR-3613-3p	CLIP-seq
MIRT1331803	hsa-miR-3614-5p	CLIP-seq
MIRT1331806	hsa-miR-3975	CLIP-seq
MIRT1331808	hsa-miR-4289	CLIP-seq
MIRT1331810	hsa-miR-4527	CLIP-seq
MIRT1331811	hsa-miR-4666-5p	CLIP-seq
MIRT2618797	hsa-miR-4667-5p	CLIP-seq
MIRT2618798	hsa-miR-4700-5p	CLIP-seq
MIRT1331813	hsa-miR-4712-3p	CLIP-seq
MIRT2618799	hsa-miR-4755-3p	CLIP-seq
MIRT1331816	hsa-miR-485-5p	CLIP-seq
MIRT1331824	hsa-miR-548l	CLIP-seq
MIRT1331825	hsa-miR-548n	CLIP-seq
MIRT1331827	hsa-miR-567	CLIP-seq
MIRT1331828	hsa-miR-580	CLIP-seq
MIRT2618800	hsa-miR-637	CLIP-seq
MIRT1331830	hsa-miR-676	CLIP-seq
MIRT1331831	hsa-miR-940	CLIP-seq
MIRT1331788	hsa-miR-1286	CLIP-seq
MIRT1331789	hsa-miR-1304	CLIP-seq
MIRT1331790	hsa-miR-1827	CLIP-seq
MIRT1331791	hsa-miR-23a	CLIP-seq
MIRT1331792	hsa-miR-23b	CLIP-seq
MIRT1331793	hsa-miR-23c	CLIP-seq
MIRT1331794	hsa-miR-24	CLIP-seq
MIRT1331795	hsa-miR-2467-5p	CLIP-seq
MIRT1331796	hsa-miR-297	CLIP-seq
MIRT1331798	hsa-miR-3160-3p	CLIP-seq
MIRT1331800	hsa-miR-34b	CLIP-seq
MIRT1331801	hsa-miR-3545-5p	CLIP-seq
MIRT1331802	hsa-miR-3613-3p	CLIP-seq
MIRT1331803	hsa-miR-3614-5p	CLIP-seq
MIRT1331806	hsa-miR-3975	CLIP-seq
MIRT1331808	hsa-miR-4289	CLIP-seq
MIRT1331810	hsa-miR-4527	CLIP-seq
MIRT1331811	hsa-miR-4666-5p	CLIP-seq
MIRT2618797	hsa-miR-4667-5p	CLIP-seq
MIRT2618798	hsa-miR-4700-5p	CLIP-seq
MIRT1331813	hsa-miR-4712-3p	CLIP-seq
MIRT2618799	hsa-miR-4755-3p	CLIP-seq
MIRT1331816	hsa-miR-485-5p	CLIP-seq
MIRT1331824	hsa-miR-548l	CLIP-seq
MIRT1331825	hsa-miR-548n	CLIP-seq
MIRT1331827	hsa-miR-567	CLIP-seq
MIRT1331828	hsa-miR-580	CLIP-seq
MIRT2618800	hsa-miR-637	CLIP-seq
MIRT1331830	hsa-miR-676	CLIP-seq
MIRT1331831	hsa-miR-940	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	19628817, 26496610, 28514442, 32296183, 33961781
GO:0005730	Component	Nucleolus	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	19628817
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006099	Process	Tricarboxylic acid cycle	IBA
GO:0006121	Process	Mitochondrial electron transport, succinate to ubiquinone	IBA
GO:0006121	Process	Mitochondrial electron transport, succinate to ubiquinone	IEA
GO:0006121	Process	Mitochondrial electron transport, succinate to ubiquinone	IMP	19628817
GO:0006470	Process	Protein dephosphorylation	IGI	23983127
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IMP	23983127
GO:0018293	Process	Protein-FAD linkage	IMP	19628817
GO:0034553	Process	Mitochondrial respiratory chain complex II assembly	IBA
GO:0034553	Process	Mitochondrial respiratory chain complex II assembly	IDA	32887801
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	23983127

MIM	HGNC	e!Ensembl
613019	26034	ENSG00000167985

Q9NX18

Protein name

Succinate dehydrogenase assembly factor 2, mitochondrial (SDH assembly factor 2) (SDHAF2)

Protein function

Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chai

PDB

6VAX , 8DYD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03937	Sdh5	67 → 140	Flavinator of succinate dehydrogenase	Domain

Sequence

MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTD
ESIETKRARLLYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYY
WATEAKPAPEIFENEVMALLRDFAKNKNKEQRLRAPDLEYLFEKPR

Sequence length

166

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Clear cell carcinoma of kidney	Likely pathogenic	rs745989557	RCV005902072	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glioma susceptibility 1	Likely pathogenic	rs745989557	RCV005902071	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary cancer-predisposing syndrome	Likely pathogenic; Pathogenic	rs1344681005, rs2134892271, rs1336819076, rs766035180, rs113560320, rs2540124290, rs2540124855, rs2540124427, rs2540110841, rs2540124377, rs2540124926, rs774508076, rs749527870, rs753554501, rs761956866 View all (4 more)	RCV002357285 RCV004039468 RCV004946934 RCV002441101 RCV000165971 View all (15 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hereditary pheochromocytoma and paraganglioma	Likely pathogenic; Pathogenic	rs1344681005, rs2134892557, rs2134892263, rs2134892271, rs1336819076, rs778397152, rs766035180, rs113560320, rs2540124080, rs1173121367, rs2540124855, rs2540124889, rs772177974, rs2540110841, rs2540124926 View all (8 more)	RCV001379490 RCV001379058 RCV001381014 RCV001866107 RCV001999776 View all (18 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Pheochromocytoma/paraganglioma syndrome 2	Likely pathogenic; Pathogenic	rs1336819076, rs766035180, rs113560320, rs2134892844, rs2540133028, rs753554501, rs761956866, rs1862009020	RCV003475212 RCV004571698 RCV000000428 RCV003472635 RCV004573569 RCV003472006 RCV001784526 RCV001262451 View all (3 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
SDHAF2-related disorder	Likely pathogenic; Pathogenic	rs1344681005	RCV004757420	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HEPATOLENTICULAR DEGENERATION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARAGANGLIOMAS 2	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (69)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	20071235, 20484225, 21784903, 22972948, 23175444, 24144290, 24322175, 24466223, 25394176, 28099933, 28384794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27587393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33560870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary hemangioma of retina	Capillary Hemangioma Of Retina	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of Endocrine Gland	Endocrine Gland cancer	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23983127, 31588224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35841118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30703481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cranial nerve compression	Cranial nerve compression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic paroxysmal anxiety	Episodic paroxysmal anxiety	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Extra-Adrenal Paraganglioma	Extra-Adrenal Paraganglioma	BEFREE	22517554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extra-Adrenal Paraganglioma	Extra-Adrenal Paraganglioma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	9889318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomus Jugulare Tumor	Glomus Jugulare Tumor	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomus tympanicum paraganglioma	Glomus tympanicum paraganglioma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomus vagale tumor	Glomus Vagale Tumor	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21224366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Form of Wilson Disease	Hepatolenticular degeneration	CTD_human_DG	23519153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	CTD_human_DG	23519153		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
hereditary paraganglioma	Hereditary Paraganglioma	BEFREE	19732718, 21771581, 24414418, 28099933		★★★★★ ★☆☆☆☆ Found in Text Mining only
hereditary paraganglioma	Hereditary Paraganglioma	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Paraganglioma-Pheochromocytoma Syndrome	Hereditary Paraganglioma-Pheochromocytoma Syndromes	CLINVAR_DG	19628817, 20071235, 21224366, 21348866, 22241717, 24414418, 26096992, 28099933, 6264239, 6286462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Paraganglioma-Pheochromocytoma Syndrome	Hereditary Paraganglioma-Pheochromocytoma Syndromes	CLINGEN_DG	19628817, 20071235, 22241717, 24322175, 6286462, 8388849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Paraganglioma-Pheochromocytoma Syndrome	Hereditary Paraganglioma-Pheochromocytoma Syndromes	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pheochromocytoma-paraganglioma	Hereditary Pheochromocytoma-Paraganglioma	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	20972721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive Retinopathy	Hypertensive Retinopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27587393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23983127, 31588224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	GENOMICS_ENGLAND_DG	27604308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14595761, 20304625, 23175444, 23291190, 26067997, 27402879, 28099933, 31588224, 31741753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	CLINVAR_DG	19628817, 20071235, 21348866, 22241717, 24414418, 28099933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	BEFREE	22972948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	9889318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	20592014, 20972721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31588224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33560870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	16080474, 19628817, 20071235, 20484225, 20592014, 21082267, 21784903, 21937622, 22290790, 22584701, 22972948, 23175444, 23291190, 23913591, 24144290 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	16080474, 19628817, 19732718, 22972948, 24466223, 25459911, 27659016, 28099933, 28384794, 8981955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma of head and neck	Paraganglioma of head and neck	BEFREE	20071235, 21224366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma of head and neck	Paraganglioma of head and neck	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
PARAGANGLIOMAS 2 (disorder)	Paraganglioma	UNIPROT_DG	19628817		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARAGANGLIOMAS 2 (disorder)	Paraganglioma	BEFREE	21742608		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARAGANGLIOMAS 2 (disorder)	Paraganglioma	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
PARAGANGLIOMAS 2 (disorder)	Paraganglioma	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
PARAGANGLIOMAS 2 (disorder)	Paraganglioma	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	20972721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	20071235, 20484225, 21784903, 22972948, 23175444, 24322175, 25394176, 28099933, 28384794		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma	Pheochromocytoma	Pubtator	20484225, 22972948, 24466223, 24694336, 25494863, 28099933, 28384794, 35026032	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15651062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulsatile Tinnitus	Pulsatile Tinnitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus Tachycardia	Sinus Tachycardia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 5	Spinocerebellar Ataxia	BEFREE	9405936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31744495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vocal Cord Paralysis	Vocal Cord Paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	19915015		★★★★★ ★☆☆☆☆ Found in Text Mining only

SDHAF2 (succinate dehydrogenase complex assembly factor 2)