Gene Gene information from NCBI Gene database.
Entrez ID 54927
Gene name Coiled-coil-helix-coiled-coil-helix domain containing 3
Gene symbol CHCHD3
Synonyms (NCBI Gene)
MICOS19MINOS3Mic19PPP1R22
Chromosome 7
Chromosome location 7q32.3-q33
Summary The protein encoded by this gene is an inner mitochondrial membrane scaffold protein. Absence of the encoded protein affects the structural integrity of mitochondrial cristae and leads to reductions in ATP production, cell growth, and oxygen consumption.
miRNA miRNA information provided by mirtarbase database.
198
miRTarBase ID miRNA Experiments Reference
MIRT042475 hsa-miR-423-3p CLASH 23622248
MIRT708515 hsa-miR-148a-5p HITS-CLIP 19536157
MIRT708514 hsa-miR-3973 HITS-CLIP 19536157
MIRT708513 hsa-miR-520g-3p HITS-CLIP 19536157
MIRT708512 hsa-miR-520h HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0001401 Component SAM complex HDA 26477565
GO:0005515 Function Protein binding IPI 16189514, 19389623, 21081504, 22228767, 25416956, 30021884, 32296183, 32814053, 33961781, 36950384
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion HDA 20833797
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613748 21906 ENSG00000106554
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NX63
Protein name MICOS complex subunit MIC19 (Coiled-coil-helix-coiled-coil-helix domain-containing protein 3)
Protein function Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane (PubMe
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05300 DUF737 15 58 Family
PF05300 DUF737 54 175 Family
Tissue specificity TISSUE SPECIFICITY: Detected at low levels in brain, placenta, lung, liver, kidney and pancreas with increased levels in heart and skeletal muscle. Higher expression in primary lung cancers than in normal lung tissue. {ECO:0000269|PubMed:22567091}.
Sequence
MGGTTSTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDE
ELKRRVAEELALEQAKKESEDQKRLKQAKELDRERAAANEQLTRAILRERICSEEERAKA
KHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFYRVTTEQYQKAAEEVEAKFK
RYESH
PVCADLQAKILQCYRENTHQTLKCSALATQYMHCVNHAKQSMLEKGG
Sequence length 227
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Heart Defects Congenital Congenital heart defect Pubtator 37404133 Associate
★☆☆☆☆
Found in Text Mining only
Hypoplastic Left Heart Syndrome Hypoplastic left heart syndrome Pubtator 37404133 Associate
★☆☆☆☆
Found in Text Mining only