Gene Gene information from NCBI Gene database.
Entrez ID 54921
Gene name Chromosome transmission fidelity factor 8
Gene symbol CHTF8
Synonyms (NCBI Gene)
CTF8DERPC
Chromosome 16
Chromosome location 16q22.1
Summary This gene encodes a short protein that forms part of the Ctf18 replication factor C (RFC) complex that occurs in both yeast and mammals. The heteroheptameric RFC complex plays a role in sister chromatid cohesion and may load the replication clamp PCNA (pr
miRNA miRNA information provided by mirtarbase database.
426
miRTarBase ID miRNA Experiments Reference
MIRT050932 hsa-miR-17-5p CLASH 23622248
MIRT048338 hsa-miR-106a-5p CLASH 23622248
MIRT038507 hsa-miR-296-3p CLASH 23622248
MIRT479253 hsa-miR-6873-5p PAR-CLIP 23592263
MIRT479254 hsa-miR-624-5p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003689 Function DNA clamp loader activity IDA 12930902
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613202 24353 ENSG00000168802
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0CG13
Protein name Chromosome transmission fidelity protein 8 homolog (hCTF8)
Protein function Chromosome cohesion factor involved in sister chromatid cohesion and fidelity of chromosome transmission. Component of one of the cell nuclear antigen loader complexes, CTF18-replication factor C (CTF18-RFC), which consists of CTF18, CTF8, DSCC1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09696 Ctf8 44 113 Ctf8 Family
Sequence
MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILY
GKIIHLEKPFAVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPI
ITSVPKK
V
Sequence length 121
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Polymerase switching on the C-strand of the telomere
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DYSLEXIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Cap Myopathy Cap myopathy Pubtator 12477976 Inhibit
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 12477976 Associate
★☆☆☆☆
Found in Text Mining only
Glycosuria Renal Renal glycosuria Pubtator 12477976 Inhibit
★☆☆☆☆
Found in Text Mining only
Prostatic Neoplasms Prostatic neoplasm Pubtator 12477976 Associate
★☆☆☆☆
Found in Text Mining only