Gene Gene information from NCBI Gene database.
Entrez ID 54915
Gene name YTH N6-methyladenosine RNA binding protein F1
Gene symbol YTHDF1
Synonyms (NCBI Gene)
C20orf21DF1
Chromosome 20
Chromosome location 20q13.33
miRNA miRNA information provided by mirtarbase database.
580
miRTarBase ID miRNA Experiments Reference
MIRT045448 hsa-miR-149-5p CLASH 23622248
MIRT044213 hsa-miR-301a-3p CLASH 23622248
MIRT043558 hsa-miR-331-3p CLASH 23622248
MIRT686268 hsa-miR-1244 HITS-CLIP 23313552
MIRT686267 hsa-miR-5697 HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
38
GO ID Ontology Definition Evidence Reference
GO:0000932 Component P-body IDA 32492408
GO:0000932 Component P-body IEA
GO:0002376 Process Immune system process IEA
GO:0002577 Process Regulation of antigen processing and presentation IEA
GO:0002577 Process Regulation of antigen processing and presentation ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616529 15867 ENSG00000149658
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BYJ9
Protein name YTH domain-containing family protein 1 (DF1) (Dermatomyositis associated with cancer putative autoantigen 1) (DACA-1)
Protein function Specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and regulates their stability (PubMed:24284625, PubMed:26318451, PubMed:32492408, PubMed:39900921). M6A is a modification present at internal sites of mRNAs and some no
PDB 4RCI , 4RCJ , 7PCU , 7QKN , 7QL7 , 7YYE , 7YYF , 7YYJ , 7YZ8 , 8BS4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04146 YTH 389 524 YT521-B-like domain Domain
Sequence
MSATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYY
PPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRF
NFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGM
NSLEQGMVGLKIGDVSSSAVKTVGSVVSSVALTGVLSGNGGTNVNMPVSKPTSWAAIASK
PAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQ
VAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAP
SVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKR
LDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIF
VKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIS
SYKHTTSIFDDFAHYE
KRQEEEEVVRKERQSRNKQ
Sequence length 559
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Familial cancer of breast Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 31653849
★☆☆☆☆
Found in Text Mining only
Ataxia Telangiectasia Ataxia telangiectasia Pubtator 40238889 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 34349094, 35075167, 35279688, 36077054 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 38154356 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 29439311, 34747720 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 32111180, 32631107, 32733931, 34221187, 35833147, 35963644, 36339682, 36923927, 37833468 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 37542141 Associate
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Colonic neoplasm Pubtator 31823961, 32596399 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 29484125, 31131257
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 31823961, 37194014 Associate
★☆☆☆☆
Found in Text Mining only