Gene Gene information from NCBI Gene database.
Entrez ID 54903
Gene name MKS transition zone complex subunit 1
Gene symbol MKS1
Synonyms (NCBI Gene)
BBS13JBTS28MESMKSPOC12
Chromosome 17
Chromosome location 17q22
Summary The protein encoded by this gene localizes to the basal body and is required for formation of the primary cilium in ciliated epithelial cells. Mutations in this gene result in Meckel syndrome type 1 and in Bardet-Biedl syndrome type 13. Multiple transcrip
SNPs SNP information provided by dbSNP.
67
SNP ID Visualize variation Clinical significance Consequence
rs62636631 C>T Conflicting-interpretations-of-pathogenicity Synonymous variant, non coding transcript variant, 5 prime UTR variant, coding sequence variant
rs111315726 C>T Conflicting-interpretations-of-pathogenicity, benign-likely-benign Missense variant, coding sequence variant, intron variant, genic downstream transcript variant
rs137853105 A>C Pathogenic, uncertain-significance Missense variant, coding sequence variant, intron variant, genic downstream transcript variant
rs142805406 G>A,C Conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant, non coding transcript variant
rs144635826 T>C Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, genic downstream transcript variant, synonymous variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
65
miRTarBase ID miRNA Experiments Reference
MIRT1150488 hsa-miR-3613-3p CLIP-seq
MIRT1150489 hsa-miR-4434 CLIP-seq
MIRT1150490 hsa-miR-4516 CLIP-seq
MIRT1150491 hsa-miR-4531 CLIP-seq
MIRT1150492 hsa-miR-4773 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
GO ID Ontology Definition Evidence Reference
GO:0001843 Process Neural tube closure IEA
GO:0003271 Process Smoothened signaling pathway involved in regulation of secondary heart field cardioblast proliferation IEA
GO:0005515 Function Protein binding IPI 17185389, 19515853, 26595381, 26638075, 32726168, 33961781
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609883 7121 ENSG00000011143
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NXB0
Protein name Tectonic-like complex member MKS1 (Meckel syndrome type 1 protein)
Protein function Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Involved in centrosome migratio
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07162 B9-C2 313 493 Ciliary basal body-associated, B9 protein Domain
Sequence
MAETVWSTDTGEAVYRSRDPVRNLRLRVHLQRITSSNFLHYQPAAELGKDLIDLATFRPQ
PTASGHRPEEDEEEEIVIGWQEKLFSQFEVDLYQNETACQSPLDYQYRQEILKLENSGGK
KNRRIFTYTDSDRYTNLEEHCQRMTTAASEVPSFLVERMANVRRRRQDRRGMEGGILKSR
IVTWEPSEEFVRNNHVINTPLQTMHIMADLGPYKKLGYKKYEHVLCTLKVDSNGVITVKP
DFTGLKGPYRIETEGEKQELWKYTIDNVSPHAQPEEEERERRVFKDLYGRHKEYLSSLVG
TDFEMTVPGALRLFVNGEVVSAQGYEYDNLYVHFFVELPTAHWSSPAFQQLSGVTQTCTT
KSLAMDKVAHFSYPFTFEAFFLHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVL
PATPGSHTLTVSTWRPVELGTVAELRRFFIGGSLELEDLSYVRIPGSFKGERLSRFGLRT
ETTGTVTFRLHCL
QQSRAFMESSSLQKRMRSVLDRLEGFSQQSSIHNVLEAFRRARRRMQ
EARESLPQDLVSPSGTLVS
Sequence length 559
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Hedgehog 'off' state
Anchoring of the basal body to the plasma membrane
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
51
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Bardet-Biedl syndrome 13 Likely pathogenic; Pathogenic rs933577333, rs747740477, rs760971749, rs1968640181, rs762377424, rs2143805609, rs1320893771, rs201362733, rs2143737350, rs2143800757, rs386834052, rs199874059, rs587777804, rs1567803107, rs2509404204
View all (63 more)
RCV002504627
RCV003473903
RCV003473975
RCV004571706
RCV002307783
View all (75 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Chronic kidney disease Likely pathogenic; Pathogenic rs754279998 RCV000414929
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial cancer of breast Likely pathogenic rs756709080 RCV005912615
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Global developmental delay Likely pathogenic; Pathogenic rs754279998 RCV000414929
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bardet-Biedl syndrome Conflicting classifications of pathogenicity; Uncertain significance ClinVar
CTD, Disgenet, Orphanet
CTD, Disgenet, Orphanet
CTD, Disgenet, Orphanet
CTD, Disgenet, Orphanet
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Cervical cancer Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 28112178
★☆☆☆☆
Found in Text Mining only
Agenesis of corpus callosum Agenesis Of Corpus Callosum BEFREE 27377014
★☆☆☆☆
Found in Text Mining only
Agenesis of corpus callosum Agenesis Of Corpus Callosum HPO_DG
★☆☆☆☆
Found in Text Mining only
Ambiguous genitalia, female Ambiguous Genitalia HPO_DG
★☆☆☆☆
Found in Text Mining only
Anencephaly Anencephaly HPO_DG
★☆☆☆☆
Found in Text Mining only
Anophthalmos Syndromic microphthalmia HPO_DG
★☆☆☆☆
Found in Text Mining only
Anus, Imperforate Imperforate anus HPO_DG
★☆☆☆☆
Found in Text Mining only
Aortic coarctation Aortic Coarctation HPO_DG
★☆☆☆☆
Found in Text Mining only
Apraxia oculomotor Cogan type Apraxia Pubtator 37131188 Associate
★☆☆☆☆
Found in Text Mining only
Arima syndrome Arima Syndrome BEFREE 17558409
★☆☆☆☆
Found in Text Mining only