Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	54897
Gene name	Castor zinc finger 1
Gene symbol	CASZ1
Synonyms (NCBI Gene)	CAS11CSTSRGZNF693dJ734G22.1
Chromosome	1
Chromosome location	1p36.22
Summary	The protein encoded by this gene is a zinc finger transcription factor. The encoded protein may function as a tumor suppressor, and single nucleotide polymorphisms in this gene are associated with blood pressure variation. Alternative splicing results in

301

Show/Hide all (301)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053612	hsa-miR-151a-5p	Luciferase reporter assayqRT-PCRWestern blot	22928040
MIRT487889	hsa-miR-6784-5p	PAR-CLIP	20371350
MIRT487888	hsa-miR-1908-3p	PAR-CLIP	20371350
MIRT487887	hsa-miR-6777-5p	PAR-CLIP	20371350
MIRT487886	hsa-miR-6889-5p	PAR-CLIP	20371350
MIRT487885	hsa-miR-5090	PAR-CLIP	20371350
MIRT487884	hsa-miR-6775-5p	PAR-CLIP	20371350
MIRT487883	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT487882	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT487881	hsa-miR-3648	PAR-CLIP	20371350
MIRT487880	hsa-miR-3195	PAR-CLIP	20371350
MIRT487878	hsa-miR-4706	PAR-CLIP	20371350
MIRT487879	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT487877	hsa-miR-885-3p	PAR-CLIP	20371350
MIRT487876	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487875	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487874	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487873	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487872	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT487871	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT487870	hsa-miR-4665-3p	PAR-CLIP	20371350
MIRT569207	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT569206	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT569204	hsa-miR-8068	PAR-CLIP	20371350
MIRT569205	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT569203	hsa-miR-147a	PAR-CLIP	20371350
MIRT569202	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT569201	hsa-miR-4455	PAR-CLIP	20371350
MIRT569200	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT549040	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT549039	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT549038	hsa-miR-4517	PAR-CLIP	20371350
MIRT549036	hsa-miR-648	PAR-CLIP	20371350
MIRT549035	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT549034	hsa-miR-520d-5p	PAR-CLIP	20371350
MIRT549033	hsa-miR-524-5p	PAR-CLIP	20371350
MIRT549031	hsa-miR-7975	PAR-CLIP	20371350
MIRT549040	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT549039	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT549038	hsa-miR-4517	PAR-CLIP	21572407
MIRT549037	hsa-miR-6838-3p	PAR-CLIP	21572407
MIRT549036	hsa-miR-648	PAR-CLIP	21572407
MIRT549035	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT549034	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT549033	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT549032	hsa-miR-4540	PAR-CLIP	21572407
MIRT549031	hsa-miR-7975	PAR-CLIP	21572407
MIRT487889	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT487888	hsa-miR-1908-3p	PAR-CLIP	23592263
MIRT487887	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT487886	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT487885	hsa-miR-5090	PAR-CLIP	23592263
MIRT487884	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT487883	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT487882	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT487881	hsa-miR-3648	PAR-CLIP	23592263
MIRT487880	hsa-miR-3195	PAR-CLIP	23592263
MIRT487878	hsa-miR-4706	PAR-CLIP	23592263
MIRT487879	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT487877	hsa-miR-885-3p	PAR-CLIP	23592263
MIRT487876	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487875	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487874	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487873	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487872	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT487871	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT487870	hsa-miR-4665-3p	PAR-CLIP	23592263
MIRT487889	hsa-miR-6784-5p	PAR-CLIP	20371350
MIRT487888	hsa-miR-1908-3p	PAR-CLIP	20371350
MIRT487887	hsa-miR-6777-5p	PAR-CLIP	20371350
MIRT487886	hsa-miR-6889-5p	PAR-CLIP	20371350
MIRT487885	hsa-miR-5090	PAR-CLIP	20371350
MIRT487884	hsa-miR-6775-5p	PAR-CLIP	20371350
MIRT487883	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT487882	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT487881	hsa-miR-3648	PAR-CLIP	20371350
MIRT487880	hsa-miR-3195	PAR-CLIP	20371350
MIRT487878	hsa-miR-4706	PAR-CLIP	20371350
MIRT487879	hsa-miR-4749-5p	PAR-CLIP	20371350
MIRT487877	hsa-miR-885-3p	PAR-CLIP	20371350
MIRT487876	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487875	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487874	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487873	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487872	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT487871	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT487870	hsa-miR-4665-3p	PAR-CLIP	20371350
MIRT569207	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT569206	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT569204	hsa-miR-8068	PAR-CLIP	20371350
MIRT569205	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT569203	hsa-miR-147a	PAR-CLIP	20371350
MIRT569202	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT569201	hsa-miR-4455	PAR-CLIP	20371350
MIRT569200	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT549040	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT549039	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT549038	hsa-miR-4517	PAR-CLIP	20371350
MIRT549036	hsa-miR-648	PAR-CLIP	20371350
MIRT549035	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT549034	hsa-miR-520d-5p	PAR-CLIP	20371350
MIRT549033	hsa-miR-524-5p	PAR-CLIP	20371350
MIRT549031	hsa-miR-7975	PAR-CLIP	20371350
MIRT549040	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT549039	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT549038	hsa-miR-4517	PAR-CLIP	21572407
MIRT549037	hsa-miR-6838-3p	PAR-CLIP	21572407
MIRT549036	hsa-miR-648	PAR-CLIP	21572407
MIRT549035	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT549034	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT549033	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT549032	hsa-miR-4540	PAR-CLIP	21572407
MIRT549031	hsa-miR-7975	PAR-CLIP	21572407
MIRT487889	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT487888	hsa-miR-1908-3p	PAR-CLIP	23592263
MIRT487887	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT487886	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT487885	hsa-miR-5090	PAR-CLIP	23592263
MIRT487884	hsa-miR-6775-5p	PAR-CLIP	23592263
MIRT487883	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT487882	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT487881	hsa-miR-3648	PAR-CLIP	23592263
MIRT487880	hsa-miR-3195	PAR-CLIP	23592263
MIRT487878	hsa-miR-4706	PAR-CLIP	23592263
MIRT487879	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT487877	hsa-miR-885-3p	PAR-CLIP	23592263
MIRT487876	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487875	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487874	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487873	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487872	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT487871	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT487870	hsa-miR-4665-3p	PAR-CLIP	23592263
MIRT864326	hsa-miR-1226	CLIP-seq
MIRT864327	hsa-miR-1237	CLIP-seq
MIRT864328	hsa-miR-125a-5p	CLIP-seq
MIRT864329	hsa-miR-125b	CLIP-seq
MIRT864330	hsa-miR-1283	CLIP-seq
MIRT864331	hsa-miR-1297	CLIP-seq
MIRT864332	hsa-miR-1323	CLIP-seq
MIRT864333	hsa-miR-1324	CLIP-seq
MIRT864334	hsa-miR-135a	CLIP-seq
MIRT864335	hsa-miR-135b	CLIP-seq
MIRT864336	hsa-miR-145	CLIP-seq
MIRT864337	hsa-miR-1470	CLIP-seq
MIRT864338	hsa-miR-148a	CLIP-seq
MIRT864339	hsa-miR-148b	CLIP-seq
MIRT864340	hsa-miR-151-3p	CLIP-seq
MIRT864341	hsa-miR-151-5p	CLIP-seq
MIRT864342	hsa-miR-151b	CLIP-seq
MIRT864343	hsa-miR-152	CLIP-seq
MIRT864344	hsa-miR-198	CLIP-seq
MIRT864345	hsa-miR-19a	CLIP-seq
MIRT864346	hsa-miR-19b	CLIP-seq
MIRT864347	hsa-miR-2116	CLIP-seq
MIRT864348	hsa-miR-2355-5p	CLIP-seq
MIRT864349	hsa-miR-26a	CLIP-seq
MIRT864350	hsa-miR-26b	CLIP-seq
MIRT864351	hsa-miR-3130-3p	CLIP-seq
MIRT864352	hsa-miR-3132	CLIP-seq
MIRT864353	hsa-miR-3148	CLIP-seq
MIRT864354	hsa-miR-3150b-3p	CLIP-seq
MIRT864355	hsa-miR-3160-5p	CLIP-seq
MIRT864356	hsa-miR-3182	CLIP-seq
MIRT864357	hsa-miR-3185	CLIP-seq
MIRT864358	hsa-miR-324-5p	CLIP-seq
MIRT864359	hsa-miR-335	CLIP-seq
MIRT864360	hsa-miR-339-5p	CLIP-seq
MIRT864361	hsa-miR-3529	CLIP-seq
MIRT864362	hsa-miR-3611	CLIP-seq
MIRT864363	hsa-miR-361-3p	CLIP-seq
MIRT864364	hsa-miR-3655	CLIP-seq
MIRT864365	hsa-miR-3663-3p	CLIP-seq
MIRT864366	hsa-miR-3667-3p	CLIP-seq
MIRT864367	hsa-miR-3668	CLIP-seq
MIRT864368	hsa-miR-3671	CLIP-seq
MIRT864369	hsa-miR-3673	CLIP-seq
MIRT864370	hsa-miR-3679-3p	CLIP-seq
MIRT864371	hsa-miR-3690	CLIP-seq
MIRT864372	hsa-miR-3692	CLIP-seq
MIRT864373	hsa-miR-375	CLIP-seq
MIRT864374	hsa-miR-379	CLIP-seq
MIRT864375	hsa-miR-3908	CLIP-seq
MIRT864376	hsa-miR-4254	CLIP-seq
MIRT864377	hsa-miR-4263	CLIP-seq
MIRT864378	hsa-miR-4273	CLIP-seq
MIRT864379	hsa-miR-4277	CLIP-seq
MIRT864380	hsa-miR-4286	CLIP-seq
MIRT864381	hsa-miR-4304	CLIP-seq
MIRT864382	hsa-miR-4319	CLIP-seq
MIRT864383	hsa-miR-4326	CLIP-seq
MIRT864384	hsa-miR-4446-5p	CLIP-seq
MIRT864385	hsa-miR-4463	CLIP-seq
MIRT864386	hsa-miR-4465	CLIP-seq
MIRT864387	hsa-miR-4469	CLIP-seq
MIRT864388	hsa-miR-4499	CLIP-seq
MIRT864389	hsa-miR-4652-3p	CLIP-seq
MIRT864390	hsa-miR-4659a-3p	CLIP-seq
MIRT864391	hsa-miR-4659b-3p	CLIP-seq
MIRT864392	hsa-miR-4660	CLIP-seq
MIRT864393	hsa-miR-4667-3p	CLIP-seq
MIRT864394	hsa-miR-4677-5p	CLIP-seq
MIRT864395	hsa-miR-4684-5p	CLIP-seq
MIRT864396	hsa-miR-4691-5p	CLIP-seq
MIRT864397	hsa-miR-4707-5p	CLIP-seq
MIRT864398	hsa-miR-4732-3p	CLIP-seq
MIRT864399	hsa-miR-4733-5p	CLIP-seq
MIRT864400	hsa-miR-4755-5p	CLIP-seq
MIRT864401	hsa-miR-4778-3p	CLIP-seq
MIRT864402	hsa-miR-4784	CLIP-seq
MIRT864403	hsa-miR-4786-5p	CLIP-seq
MIRT864404	hsa-miR-4789-3p	CLIP-seq
MIRT864405	hsa-miR-483-3p	CLIP-seq
MIRT864406	hsa-miR-513a-3p	CLIP-seq
MIRT864407	hsa-miR-548c-3p	CLIP-seq
MIRT864408	hsa-miR-548o	CLIP-seq
MIRT864409	hsa-miR-571	CLIP-seq
MIRT864410	hsa-miR-576-5p	CLIP-seq
MIRT864411	hsa-miR-578	CLIP-seq
MIRT864412	hsa-miR-593	CLIP-seq
MIRT864413	hsa-miR-656	CLIP-seq
MIRT864414	hsa-miR-670	CLIP-seq
MIRT864415	hsa-miR-764	CLIP-seq
MIRT864416	hsa-miR-767-5p	CLIP-seq
MIRT864417	hsa-miR-2276	CLIP-seq
MIRT864418	hsa-miR-4287	CLIP-seq
MIRT864387	hsa-miR-4469	CLIP-seq
MIRT864419	hsa-miR-4685-3p	CLIP-seq
MIRT864420	hsa-miR-4708-3p	CLIP-seq
MIRT864421	hsa-miR-4713-5p	CLIP-seq
MIRT1956189	hsa-miR-1178	CLIP-seq
MIRT1956190	hsa-miR-1247	CLIP-seq
MIRT864330	hsa-miR-1283	CLIP-seq
MIRT1956191	hsa-miR-1285	CLIP-seq
MIRT864331	hsa-miR-1297	CLIP-seq
MIRT864337	hsa-miR-1470	CLIP-seq
MIRT1956192	hsa-miR-15a	CLIP-seq
MIRT1956193	hsa-miR-15b	CLIP-seq
MIRT1956194	hsa-miR-16	CLIP-seq
MIRT1956195	hsa-miR-1910	CLIP-seq
MIRT1956196	hsa-miR-195	CLIP-seq
MIRT1956197	hsa-miR-1973	CLIP-seq
MIRT864349	hsa-miR-26a	CLIP-seq
MIRT864350	hsa-miR-26b	CLIP-seq
MIRT1956198	hsa-miR-3187-5p	CLIP-seq
MIRT1956199	hsa-miR-3605-3p	CLIP-seq
MIRT864363	hsa-miR-361-3p	CLIP-seq
MIRT1956200	hsa-miR-3657	CLIP-seq
MIRT1956201	hsa-miR-3686	CLIP-seq
MIRT1956202	hsa-miR-378g	CLIP-seq
MIRT1956203	hsa-miR-3918	CLIP-seq
MIRT1956204	hsa-miR-424	CLIP-seq
MIRT864386	hsa-miR-4465	CLIP-seq
MIRT864387	hsa-miR-4469	CLIP-seq
MIRT1956205	hsa-miR-4486	CLIP-seq
MIRT864393	hsa-miR-4667-3p	CLIP-seq
MIRT1956206	hsa-miR-4669	CLIP-seq
MIRT864397	hsa-miR-4707-5p	CLIP-seq
MIRT1956207	hsa-miR-4738-5p	CLIP-seq
MIRT1956208	hsa-miR-4742-3p	CLIP-seq
MIRT864405	hsa-miR-483-3p	CLIP-seq
MIRT1956209	hsa-miR-497	CLIP-seq
MIRT1956210	hsa-miR-612	CLIP-seq
MIRT1956211	hsa-miR-760	CLIP-seq
MIRT2193842	hsa-miR-1229	CLIP-seq
MIRT864330	hsa-miR-1283	CLIP-seq
MIRT864337	hsa-miR-1470	CLIP-seq
MIRT864338	hsa-miR-148a	CLIP-seq
MIRT864339	hsa-miR-148b	CLIP-seq
MIRT864341	hsa-miR-151-5p	CLIP-seq
MIRT864342	hsa-miR-151b	CLIP-seq
MIRT864343	hsa-miR-152	CLIP-seq
MIRT2193843	hsa-miR-1908	CLIP-seq
MIRT2193844	hsa-miR-197	CLIP-seq
MIRT864347	hsa-miR-2116	CLIP-seq
MIRT864351	hsa-miR-3130-3p	CLIP-seq
MIRT864354	hsa-miR-3150b-3p	CLIP-seq
MIRT864355	hsa-miR-3160-5p	CLIP-seq
MIRT864363	hsa-miR-361-3p	CLIP-seq
MIRT2193845	hsa-miR-3621	CLIP-seq
MIRT864369	hsa-miR-3673	CLIP-seq
MIRT1956201	hsa-miR-3686	CLIP-seq
MIRT2193846	hsa-miR-3937	CLIP-seq
MIRT864378	hsa-miR-4273	CLIP-seq
MIRT864379	hsa-miR-4277	CLIP-seq
MIRT2193847	hsa-miR-4527	CLIP-seq
MIRT2193848	hsa-miR-4639-3p	CLIP-seq
MIRT864390	hsa-miR-4659a-3p	CLIP-seq
MIRT864391	hsa-miR-4659b-3p	CLIP-seq
MIRT864392	hsa-miR-4660	CLIP-seq
MIRT864393	hsa-miR-4667-3p	CLIP-seq
MIRT864397	hsa-miR-4707-5p	CLIP-seq
MIRT1956208	hsa-miR-4742-3p	CLIP-seq
MIRT2193849	hsa-miR-4757-5p	CLIP-seq
MIRT864402	hsa-miR-4784	CLIP-seq
MIRT864403	hsa-miR-4786-5p	CLIP-seq
MIRT2193850	hsa-miR-4793-3p	CLIP-seq
MIRT2193851	hsa-miR-4797-5p	CLIP-seq
MIRT864409	hsa-miR-571	CLIP-seq
MIRT2193852	hsa-miR-663	CLIP-seq
MIRT864415	hsa-miR-764	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IDA	27693370
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	27693370
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	27693370
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0045664	Process	Regulation of neuron differentiation	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	27693370
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	27693370
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
609895	26002	ENSG00000130940

Q86V15

Protein name

Zinc finger protein castor homolog 1 (Castor-related protein) (Putative survival-related protein) (Zinc finger protein 693)

Protein function

Transcriptional activator (PubMed:23639441, PubMed:27693370). Involved in vascular assembly and morphogenesis through direct transcriptional regulation of EGFL7 (PubMed:23639441).

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, lung, skeletal muscle, pancreas, testis, small intestine, and stomach, but it is not detectable in the adult brain. {ECO:0000269|PubMed:16631614}.

Sequence

MDLGTAEGTRCTDPPAGKPAMAPKRKGGLKLNAICAKLSRQVVVEKRADAGSHTEGSPSQ
PRDQERSGPESGAARAPRSEEDKRRAVIEKWVNGEYSEEPAPTPVLGRIAREGLELPPEG
VYMVQPQGCSDEEDHAEEPSKDGGALEEKDSDGAASKEDSGPSTRQASGEASSLRDYAAS
TMTEFLGMFGYDDQNTRDELARKISFEKLHAGSTPEAATSSMLPTSEDTLSKRARFSKYE
EYIRKLKAGEQLSWPAPSTKTEERVGKEVVGTLPGLRLPSSTAHLETKATILPLPSHSSV
QMQNLVARASKYDFFIQKLKTGENLRPQNGSTYKKPSKYDLENVKYLHLFKPGEGSPDMG
GAIAFKTGKVGRPSKYDVRGIQKPGPAKVPPTPSLAPAPLASVPSAPSAPGPGPEPPASL
SFNTPEYLKSTFSKTDSITTGTVSTVKNGLPTDKPAVTEDVNIYQKYIARFSGSQHCGHI
HCAYQYREHYHCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYH
GCHLNGKSTHYHCMQVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADC
QFYGQKTTHFHCRRPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCV
YSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPPSLLGAKDTEHEES
SNDDLVDFSALSSKNSSLSASPTSQQSSASLAAATAATEAGPSATKPPNSKISGLLPQGL
PGSIPLALALSNSGLPTPTPYFPILAGRGSTSLPVGTPSLLGAVSSGSAASATPDTPTLV
ASGAGDSAPVAAASVPAPPASIMERISASKGLISPMMARLAAAALKPSATFDPGSGQQVT
PARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPANSSLLSSLMNK
MSQGNPGLGSLLNIKAEAEGSPAAEPSPFLGKAVKALVQEKLAEPWKVYLRRFGTKDFCD
GQCDFLHKAHFHCVVEECGALFSTLDGAIKHANFHFRTEGGAAKGNTEAAFPASAAETKP
PMAPSSPPVPPVTTATVSSLEGPAPSPASVPSTPTLLAWKQLASTIPQMPQIPASVPHLP
ASPLATTSLENAKPQVKPGFLQFQENDPCLATDCKYANKFHFHCLFGNCKYVCKTSGKAE
SHCLDHINPNNNLVNVRDQFAYYSLQCLCPNQHCEFRMRGHYHCLRTGCYFVTNITTKLP
WHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSH
ARKHMRRMLGKNFDRVPPSQGPPGLMDAETDECMDYTGCSPGAMSSESSTMDRSCSSTPV
GNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLY
EDCKDAACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKASLS
CHFADCPFSGTSTHFHCLRCRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSADCAVP
DCKYKLKCSHFHCTFPGCRHTVVGMSQMDSHKRKHEKQERGEPAAEGPAPGPPISLDGSL
SLGAEPGSLLFLQSAAAGLGLALGDAGDPGPPDAAAPGPREGAAAAAAAAGESSQEDEEE
ELELPEEEAEDDEDEDDDEDDDDEDDDEDDDDEDLRTDSEESLPEAAAEAAGAGARTPAL
AALAALGAPGPAPTAASSP

Sequence length

1759

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Primary dilated cardiomyopathy	Pathogenic	rs2100221588, rs1344522422	RCV001530185 RCV003319265	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (48)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
1P36 DELETION SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANAL POLYP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism spectrum disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CASZ1-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHROMOSOME 1P36 DELETION SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC KETOACIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutrophil inclusion bodies	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POTASSIUM DEFICIENCY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY ALDOSTERONISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL VESSEL STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (114)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	29531354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	GWASCAT_DG	28196072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29071208, 29785360, 31421506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhidrosis	Anhidrosis	BEFREE	3782855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30337922, 30658195, 31555545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30337922, 30658195, 31555545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015, 30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	BEFREE	31314641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28343053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26576432, 28825224, 30454048		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34147074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19995649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31481981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38458428	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies, Primary	Cardiomyopathy	BEFREE	28099117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	31268246, 36293425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated with Left Ventricular Noncompaction	Dilated cardiomyopathy	Pubtator	31268246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28099117, 28945738, 31268246		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28099117, 28945738, 31268246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26211667, 31555545, 31807542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34895303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31809712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27840187, 28590584, 28691140, 29930399		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	CTD_human_DG	29531354		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	GWASCAT_DG	29531354		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	29595758		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	29595758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	31570750, 35218958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30940143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31423171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29084506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26474385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	28884027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	27693370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	28209766, 28443506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31481981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30658195		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	27693370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	20007901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30826358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	38458428	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	33004838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30337922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30337922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30125508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28526556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	31273354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27939327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	29436118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	28443506		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial dilated cardiomyopathy	Cardiomyopathy	BEFREE	28099117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26646793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	35737725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28209766, 28443506		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	31268246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	14667270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29432123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	31545351, 34793544	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	GWASCAT_DG	25249183, 30487518, 31545351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27324226, 28228748, 28443506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	25333685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30337922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29078283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GWASCAT_DG	29531354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left ventricular noncompaction cardiomyopathy	Cardiomyopathy	BEFREE	31268246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29933410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29506567, 29742497, 30981109, 31115549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	38575158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38575158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15297397, 2757057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26576432, 28825224, 30454048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27939327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28402940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19995649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29307681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29662167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27626309, 28472059, 29506567, 29739787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31423171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26398410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	29525839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	34895303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	38077400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease, Lower	Motor Neuron Disease	BEFREE	29071208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28737990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31366074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16631614, 21252912, 21490919, 22262398, 22331471, 23614654, 23892435, 27270431, 28236769, 29078283, 29084506, 29506567, 29656783, 31481981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17940511, 21252912, 21490919, 22068036, 22331471, 23892435, 27270431, 31481981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21252912, 27270431, 31481981, 36243768	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23892435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29867125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29432123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33205602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29739787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36518628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillon-Lefevre Disease	Papillon-Lefevre Disease	BEFREE	29785360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive bulbar palsy	Bulbar palsy	BEFREE	31421506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29307681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29662167		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37686409	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	38458428	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	29084506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	38458428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	28682427	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	15297397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30241336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	31570750, 34358671, 35218958, 40108671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	GWASCAT_DG	30566020, 30998689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	31570750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	28693373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	27693370, 31268246		★★★★★ ★☆☆☆☆ Found in Text Mining only

CASZ1 (castor zinc finger 1)