Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54890
Gene name	AlkB homolog 5, RNA demethylase
Gene symbol	ALKBH5
Synonyms (NCBI Gene)	ABH5OFOXDOFOXD1
Chromosome	17
Chromosome location	17p11.2\|17p11.2

483

Show/Hide all (483)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049251	hsa-miR-92a-3p	CLASH	23622248
MIRT049251	hsa-miR-92a-3p	CLASH	23622248
MIRT048722	hsa-miR-96-5p	CLASH	23622248
MIRT042009	hsa-miR-484	CLASH	23622248
MIRT039912	hsa-miR-615-3p	CLASH	23622248
MIRT076212	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT568540	hsa-miR-2278	PAR-CLIP	20371350
MIRT568539	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT076216	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT568538	hsa-miR-8063	PAR-CLIP	20371350
MIRT568536	hsa-miR-4698	PAR-CLIP	20371350
MIRT568537	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT076214	hsa-miR-4732-5p	PAR-CLIP	20371350
MIRT076210	hsa-miR-376a-5p	PAR-CLIP	20371350
MIRT568535	hsa-miR-5701	PAR-CLIP	20371350
MIRT076209	hsa-miR-29b-2-5p	PAR-CLIP	20371350
MIRT076215	hsa-miR-4760-5p	PAR-CLIP	20371350
MIRT076218	hsa-miR-8061	PAR-CLIP	20371350
MIRT568534	hsa-miR-607	PAR-CLIP	20371350
MIRT076211	hsa-miR-659-3p	PAR-CLIP	20371350
MIRT076213	hsa-miR-3674	PAR-CLIP	20371350
MIRT560144	hsa-miR-4459	PAR-CLIP	20371350
MIRT560143	hsa-miR-6886-5p	PAR-CLIP	20371350
MIRT560142	hsa-miR-5681a	PAR-CLIP	20371350
MIRT560141	hsa-miR-4722-5p	PAR-CLIP	20371350
MIRT560140	hsa-miR-6076	PAR-CLIP	20371350
MIRT560139	hsa-miR-6797-3p	PAR-CLIP	20371350
MIRT344366	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT560138	hsa-miR-609	PAR-CLIP	20371350
MIRT560137	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT560136	hsa-miR-4666b	PAR-CLIP	20371350
MIRT560135	hsa-miR-3680-3p	PAR-CLIP	20371350
MIRT454029	hsa-miR-4773	PAR-CLIP	23592263
MIRT454028	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT454027	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT454026	hsa-miR-1253	PAR-CLIP	23592263
MIRT454025	hsa-miR-3665	PAR-CLIP	23592263
MIRT454024	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT454023	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT454022	hsa-miR-4736	PAR-CLIP	23592263
MIRT454020	hsa-miR-7150	PAR-CLIP	23592263
MIRT454021	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT454019	hsa-miR-3154	PAR-CLIP	23592263
MIRT454018	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT454017	hsa-miR-9500	PAR-CLIP	23592263
MIRT454016	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT454015	hsa-miR-7515	PAR-CLIP	23592263
MIRT454014	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT285972	hsa-miR-3148	PAR-CLIP	23592263
MIRT454013	hsa-miR-3202	PAR-CLIP	23592263
MIRT454012	hsa-miR-4434	PAR-CLIP	23592263
MIRT454011	hsa-miR-4516	PAR-CLIP	23592263
MIRT454010	hsa-miR-5703	PAR-CLIP	23592263
MIRT454008	hsa-miR-3153	PAR-CLIP	23592263
MIRT454009	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT454007	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT454006	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT454005	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT454004	hsa-miR-4531	PAR-CLIP	23592263
MIRT454003	hsa-miR-4435	PAR-CLIP	23592263
MIRT728355	hsa-miR-193a-3p	HITS-CLIP	22473208
MIRT728354	hsa-miR-193b-3p	HITS-CLIP	22473208
MIRT454024	hsa-miR-1207-5p	PAR-CLIP	26701625
MIRT454026	hsa-miR-1253	PAR-CLIP	26701625
MIRT454028	hsa-miR-125a-3p	PAR-CLIP	26701625
MIRT454025	hsa-miR-3665	PAR-CLIP	26701625
MIRT454012	hsa-miR-4434	PAR-CLIP	26701625
MIRT454011	hsa-miR-4516	PAR-CLIP	26701625
MIRT454004	hsa-miR-4531	PAR-CLIP	26701625
MIRT454022	hsa-miR-4736	PAR-CLIP	26701625
MIRT454023	hsa-miR-4763-3p	PAR-CLIP	26701625
MIRT454029	hsa-miR-4773	PAR-CLIP	26701625
MIRT454027	hsa-miR-4795-5p	PAR-CLIP	26701625
MIRT454010	hsa-miR-5703	PAR-CLIP	26701625
MIRT454014	hsa-miR-6770-5p	PAR-CLIP	26701625
MIRT454020	hsa-miR-7150	PAR-CLIP	26701625
MIRT728355	hsa-miR-193a-3p	Immunohistochemistry (IHC)Immunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting	33968717
MIRT735719	hsa-miR-1252-5p	Luciferase reporter assayWestern blottingqRT-PCR	33975615
MIRT076212	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT568540	hsa-miR-2278	PAR-CLIP	20371350
MIRT568539	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT076216	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT568538	hsa-miR-8063	PAR-CLIP	20371350
MIRT568536	hsa-miR-4698	PAR-CLIP	20371350
MIRT568537	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT076214	hsa-miR-4732-5p	PAR-CLIP	20371350
MIRT076210	hsa-miR-376a-5p	PAR-CLIP	20371350
MIRT568535	hsa-miR-5701	PAR-CLIP	20371350
MIRT076209	hsa-miR-29b-2-5p	PAR-CLIP	20371350
MIRT076215	hsa-miR-4760-5p	PAR-CLIP	20371350
MIRT076218	hsa-miR-8061	PAR-CLIP	20371350
MIRT568534	hsa-miR-607	PAR-CLIP	20371350
MIRT076211	hsa-miR-659-3p	PAR-CLIP	20371350
MIRT076213	hsa-miR-3674	PAR-CLIP	20371350
MIRT560144	hsa-miR-4459	PAR-CLIP	20371350
MIRT560143	hsa-miR-6886-5p	PAR-CLIP	20371350
MIRT560142	hsa-miR-5681a	PAR-CLIP	20371350
MIRT560141	hsa-miR-4722-5p	PAR-CLIP	20371350
MIRT560140	hsa-miR-6076	PAR-CLIP	20371350
MIRT560139	hsa-miR-6797-3p	PAR-CLIP	20371350
MIRT344366	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT560138	hsa-miR-609	PAR-CLIP	20371350
MIRT560137	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT560136	hsa-miR-4666b	PAR-CLIP	20371350
MIRT560135	hsa-miR-3680-3p	PAR-CLIP	20371350
MIRT454029	hsa-miR-4773	PAR-CLIP	23592263
MIRT454028	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT454027	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT454026	hsa-miR-1253	PAR-CLIP	23592263
MIRT454025	hsa-miR-3665	PAR-CLIP	23592263
MIRT454024	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT454023	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT454022	hsa-miR-4736	PAR-CLIP	23592263
MIRT454020	hsa-miR-7150	PAR-CLIP	23592263
MIRT454021	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT454019	hsa-miR-3154	PAR-CLIP	23592263
MIRT454018	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT454017	hsa-miR-9500	PAR-CLIP	23592263
MIRT454016	hsa-miR-3190-5p	PAR-CLIP	23592263
MIRT454015	hsa-miR-7515	PAR-CLIP	23592263
MIRT454014	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT285972	hsa-miR-3148	PAR-CLIP	23592263
MIRT454013	hsa-miR-3202	PAR-CLIP	23592263
MIRT454012	hsa-miR-4434	PAR-CLIP	23592263
MIRT454011	hsa-miR-4516	PAR-CLIP	23592263
MIRT454010	hsa-miR-5703	PAR-CLIP	23592263
MIRT454008	hsa-miR-3153	PAR-CLIP	23592263
MIRT454009	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT454007	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT454006	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT454005	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT454004	hsa-miR-4531	PAR-CLIP	23592263
MIRT454003	hsa-miR-4435	PAR-CLIP	23592263
MIRT778797	hsa-miR-1193	CLIP-seq
MIRT778798	hsa-miR-1268	CLIP-seq
MIRT778799	hsa-miR-1268b	CLIP-seq
MIRT778800	hsa-miR-1294	CLIP-seq
MIRT778801	hsa-miR-141	CLIP-seq
MIRT778802	hsa-miR-1909	CLIP-seq
MIRT778803	hsa-miR-193b	CLIP-seq
MIRT778804	hsa-miR-200a	CLIP-seq
MIRT778805	hsa-miR-2467-5p	CLIP-seq
MIRT778806	hsa-miR-298	CLIP-seq
MIRT778807	hsa-miR-3126-5p	CLIP-seq
MIRT778808	hsa-miR-3166	CLIP-seq
MIRT778809	hsa-miR-3188	CLIP-seq
MIRT778810	hsa-miR-3200-3p	CLIP-seq
MIRT778811	hsa-miR-3200-5p	CLIP-seq
MIRT778812	hsa-miR-3691-5p	CLIP-seq
MIRT778813	hsa-miR-3913-3p	CLIP-seq
MIRT778814	hsa-miR-3975	CLIP-seq
MIRT778815	hsa-miR-4276	CLIP-seq
MIRT778816	hsa-miR-4297	CLIP-seq
MIRT778817	hsa-miR-4316	CLIP-seq
MIRT778818	hsa-miR-4327	CLIP-seq
MIRT778819	hsa-miR-4330	CLIP-seq
MIRT778820	hsa-miR-4419a	CLIP-seq
MIRT778821	hsa-miR-4468	CLIP-seq
MIRT778822	hsa-miR-4499	CLIP-seq
MIRT778823	hsa-miR-4510	CLIP-seq
MIRT778824	hsa-miR-4539	CLIP-seq
MIRT778825	hsa-miR-4649-5p	CLIP-seq
MIRT778826	hsa-miR-4677-3p	CLIP-seq
MIRT778827	hsa-miR-4699-5p	CLIP-seq
MIRT778828	hsa-miR-4701-5p	CLIP-seq
MIRT778829	hsa-miR-4724-5p	CLIP-seq
MIRT778830	hsa-miR-4766-5p	CLIP-seq
MIRT778831	hsa-miR-4768-3p	CLIP-seq
MIRT778832	hsa-miR-4771	CLIP-seq
MIRT778833	hsa-miR-4777-5p	CLIP-seq
MIRT778834	hsa-miR-485-5p	CLIP-seq
MIRT778835	hsa-miR-491-3p	CLIP-seq
MIRT778836	hsa-miR-508-5p	CLIP-seq
MIRT778837	hsa-miR-519a	CLIP-seq
MIRT778838	hsa-miR-519b-3p	CLIP-seq
MIRT778839	hsa-miR-519c-3p	CLIP-seq
MIRT778840	hsa-miR-548p	CLIP-seq
MIRT778841	hsa-miR-556-5p	CLIP-seq
MIRT778842	hsa-miR-588	CLIP-seq
MIRT778843	hsa-miR-766	CLIP-seq
MIRT778844	hsa-miR-769-5p	CLIP-seq
MIRT778845	hsa-miR-892b	CLIP-seq
MIRT778846	hsa-miR-922	CLIP-seq
MIRT778847	hsa-miR-944	CLIP-seq
MIRT1929855	hsa-miR-1184	CLIP-seq
MIRT1929856	hsa-miR-1185	CLIP-seq
MIRT1929857	hsa-miR-1205	CLIP-seq
MIRT1929858	hsa-miR-1226	CLIP-seq
MIRT1929859	hsa-miR-1255a	CLIP-seq
MIRT1929860	hsa-miR-1255b	CLIP-seq
MIRT1929861	hsa-miR-125a-5p	CLIP-seq
MIRT1929862	hsa-miR-125b	CLIP-seq
MIRT778800	hsa-miR-1294	CLIP-seq
MIRT778801	hsa-miR-141	CLIP-seq
MIRT778804	hsa-miR-200a	CLIP-seq
MIRT1929863	hsa-miR-214	CLIP-seq
MIRT778805	hsa-miR-2467-5p	CLIP-seq
MIRT778806	hsa-miR-298	CLIP-seq
MIRT1929864	hsa-miR-31	CLIP-seq
MIRT778807	hsa-miR-3126-5p	CLIP-seq
MIRT1929865	hsa-miR-3136-3p	CLIP-seq
MIRT1929866	hsa-miR-3158-5p	CLIP-seq
MIRT1929867	hsa-miR-3161	CLIP-seq
MIRT778808	hsa-miR-3166	CLIP-seq
MIRT1929868	hsa-miR-3176	CLIP-seq
MIRT778809	hsa-miR-3188	CLIP-seq
MIRT1929869	hsa-miR-320e	CLIP-seq
MIRT1929870	hsa-miR-34b	CLIP-seq
MIRT1929871	hsa-miR-3605-5p	CLIP-seq
MIRT1929872	hsa-miR-3612	CLIP-seq
MIRT1929873	hsa-miR-3619-5p	CLIP-seq
MIRT1929874	hsa-miR-3670	CLIP-seq
MIRT1929875	hsa-miR-3679-5p	CLIP-seq
MIRT1929876	hsa-miR-371b-5p	CLIP-seq
MIRT778813	hsa-miR-3913-3p	CLIP-seq
MIRT1929877	hsa-miR-3922-3p	CLIP-seq
MIRT1929878	hsa-miR-3943	CLIP-seq
MIRT778814	hsa-miR-3975	CLIP-seq
MIRT778815	hsa-miR-4276	CLIP-seq
MIRT1929879	hsa-miR-4291	CLIP-seq
MIRT778817	hsa-miR-4316	CLIP-seq
MIRT1929880	hsa-miR-4319	CLIP-seq
MIRT1929881	hsa-miR-4323	CLIP-seq
MIRT1929882	hsa-miR-4324	CLIP-seq
MIRT778820	hsa-miR-4419a	CLIP-seq
MIRT1929883	hsa-miR-4436a	CLIP-seq
MIRT778821	hsa-miR-4468	CLIP-seq
MIRT778822	hsa-miR-4499	CLIP-seq
MIRT778823	hsa-miR-4510	CLIP-seq
MIRT778824	hsa-miR-4539	CLIP-seq
MIRT778825	hsa-miR-4649-5p	CLIP-seq
MIRT1929884	hsa-miR-4650-5p	CLIP-seq
MIRT778826	hsa-miR-4677-3p	CLIP-seq
MIRT1929885	hsa-miR-4690-3p	CLIP-seq
MIRT1929886	hsa-miR-4695-5p	CLIP-seq
MIRT778829	hsa-miR-4724-5p	CLIP-seq
MIRT1929887	hsa-miR-4749-3p	CLIP-seq
MIRT1929888	hsa-miR-4758-3p	CLIP-seq
MIRT778831	hsa-miR-4768-3p	CLIP-seq
MIRT778832	hsa-miR-4771	CLIP-seq
MIRT778834	hsa-miR-485-5p	CLIP-seq
MIRT1929889	hsa-miR-544	CLIP-seq
MIRT1929890	hsa-miR-545	CLIP-seq
MIRT1929891	hsa-miR-604	CLIP-seq
MIRT1929892	hsa-miR-622	CLIP-seq
MIRT1929893	hsa-miR-634	CLIP-seq
MIRT1929894	hsa-miR-647	CLIP-seq
MIRT1929895	hsa-miR-650	CLIP-seq
MIRT1929896	hsa-miR-658	CLIP-seq
MIRT1929897	hsa-miR-761	CLIP-seq
MIRT1929898	hsa-miR-765	CLIP-seq
MIRT778846	hsa-miR-922	CLIP-seq
MIRT778798	hsa-miR-1268	CLIP-seq
MIRT778799	hsa-miR-1268b	CLIP-seq
MIRT2170666	hsa-miR-1283	CLIP-seq
MIRT2170667	hsa-miR-302a	CLIP-seq
MIRT2170668	hsa-miR-302b	CLIP-seq
MIRT2170669	hsa-miR-302c	CLIP-seq
MIRT2170670	hsa-miR-302d	CLIP-seq
MIRT2170671	hsa-miR-302e	CLIP-seq
MIRT2170672	hsa-miR-3074-3p	CLIP-seq
MIRT2170673	hsa-miR-3127-5p	CLIP-seq
MIRT2170674	hsa-miR-3157-5p	CLIP-seq
MIRT2170675	hsa-miR-372	CLIP-seq
MIRT2170676	hsa-miR-373	CLIP-seq
MIRT2170677	hsa-miR-3918	CLIP-seq
MIRT1929878	hsa-miR-3943	CLIP-seq
MIRT1929881	hsa-miR-4323	CLIP-seq
MIRT1929885	hsa-miR-4690-3p	CLIP-seq
MIRT2170678	hsa-miR-4772-3p	CLIP-seq
MIRT2170679	hsa-miR-4789-3p	CLIP-seq
MIRT2170680	hsa-miR-4793-3p	CLIP-seq
MIRT2170681	hsa-miR-512-3p	CLIP-seq
MIRT2170682	hsa-miR-520a-3p	CLIP-seq
MIRT2170683	hsa-miR-520b	CLIP-seq
MIRT2170684	hsa-miR-520c-3p	CLIP-seq
MIRT2170685	hsa-miR-520d-3p	CLIP-seq
MIRT2170686	hsa-miR-520e	CLIP-seq
MIRT2170687	hsa-miR-548a-3p	CLIP-seq
MIRT2170688	hsa-miR-548e	CLIP-seq
MIRT2170689	hsa-miR-548f	CLIP-seq
MIRT2170690	hsa-miR-587	CLIP-seq
MIRT2170691	hsa-miR-891b	CLIP-seq
MIRT778846	hsa-miR-922	CLIP-seq
MIRT1929856	hsa-miR-1185	CLIP-seq
MIRT778797	hsa-miR-1193	CLIP-seq
MIRT2473322	hsa-miR-1208	CLIP-seq
MIRT1929859	hsa-miR-1255a	CLIP-seq
MIRT1929860	hsa-miR-1255b	CLIP-seq
MIRT778798	hsa-miR-1268	CLIP-seq
MIRT778799	hsa-miR-1268b	CLIP-seq
MIRT778800	hsa-miR-1294	CLIP-seq
MIRT2473323	hsa-miR-129-5p	CLIP-seq
MIRT2473324	hsa-miR-146a	CLIP-seq
MIRT2473325	hsa-miR-146b-5p	CLIP-seq
MIRT778802	hsa-miR-1909	CLIP-seq
MIRT778803	hsa-miR-193b	CLIP-seq
MIRT2473326	hsa-miR-197	CLIP-seq
MIRT1929863	hsa-miR-214	CLIP-seq
MIRT1929864	hsa-miR-31	CLIP-seq
MIRT2473327	hsa-miR-3127-3p	CLIP-seq
MIRT1929865	hsa-miR-3136-3p	CLIP-seq
MIRT2473328	hsa-miR-3138	CLIP-seq
MIRT1929867	hsa-miR-3161	CLIP-seq
MIRT2473329	hsa-miR-3194-3p	CLIP-seq
MIRT778810	hsa-miR-3200-3p	CLIP-seq
MIRT778811	hsa-miR-3200-5p	CLIP-seq
MIRT1929869	hsa-miR-320e	CLIP-seq
MIRT2473330	hsa-miR-338-3p	CLIP-seq
MIRT1929870	hsa-miR-34b	CLIP-seq
MIRT1929871	hsa-miR-3605-5p	CLIP-seq
MIRT2473331	hsa-miR-3613-3p	CLIP-seq
MIRT2473332	hsa-miR-3617	CLIP-seq
MIRT1929873	hsa-miR-3619-5p	CLIP-seq
MIRT1929875	hsa-miR-3679-5p	CLIP-seq
MIRT2473333	hsa-miR-3681	CLIP-seq
MIRT2473334	hsa-miR-3688-5p	CLIP-seq
MIRT778812	hsa-miR-3691-5p	CLIP-seq
MIRT1929876	hsa-miR-371b-5p	CLIP-seq
MIRT1929878	hsa-miR-3943	CLIP-seq
MIRT2473335	hsa-miR-412	CLIP-seq
MIRT2473336	hsa-miR-4286	CLIP-seq
MIRT1929879	hsa-miR-4291	CLIP-seq
MIRT778816	hsa-miR-4297	CLIP-seq
MIRT778817	hsa-miR-4316	CLIP-seq
MIRT2473337	hsa-miR-4318	CLIP-seq
MIRT1929881	hsa-miR-4323	CLIP-seq
MIRT778818	hsa-miR-4327	CLIP-seq
MIRT2473338	hsa-miR-4426	CLIP-seq
MIRT1929883	hsa-miR-4436a	CLIP-seq
MIRT2473339	hsa-miR-4481	CLIP-seq
MIRT2473340	hsa-miR-4503	CLIP-seq
MIRT2473341	hsa-miR-4509	CLIP-seq
MIRT2473342	hsa-miR-4517	CLIP-seq
MIRT2473343	hsa-miR-452	CLIP-seq
MIRT2473344	hsa-miR-4530	CLIP-seq
MIRT2473345	hsa-miR-4645-5p	CLIP-seq
MIRT2473346	hsa-miR-4647	CLIP-seq
MIRT2473347	hsa-miR-4662b	CLIP-seq
MIRT2473348	hsa-miR-4668-5p	CLIP-seq
MIRT2473349	hsa-miR-4673	CLIP-seq
MIRT2473350	hsa-miR-4676-3p	CLIP-seq
MIRT778826	hsa-miR-4677-3p	CLIP-seq
MIRT2473351	hsa-miR-4682	CLIP-seq
MIRT1929885	hsa-miR-4690-3p	CLIP-seq
MIRT778828	hsa-miR-4701-5p	CLIP-seq
MIRT2473352	hsa-miR-4711-5p	CLIP-seq
MIRT2473353	hsa-miR-4712-3p	CLIP-seq
MIRT2473354	hsa-miR-4716-3p	CLIP-seq
MIRT2473355	hsa-miR-4724-3p	CLIP-seq
MIRT2473356	hsa-miR-4742-5p	CLIP-seq
MIRT2473357	hsa-miR-4745-5p	CLIP-seq
MIRT1929887	hsa-miR-4749-3p	CLIP-seq
MIRT1929888	hsa-miR-4758-3p	CLIP-seq
MIRT2473358	hsa-miR-4758-5p	CLIP-seq
MIRT778830	hsa-miR-4766-5p	CLIP-seq
MIRT778831	hsa-miR-4768-3p	CLIP-seq
MIRT2473359	hsa-miR-4775	CLIP-seq
MIRT778833	hsa-miR-4777-5p	CLIP-seq
MIRT2170680	hsa-miR-4793-3p	CLIP-seq
MIRT2473360	hsa-miR-4795-3p	CLIP-seq
MIRT2473361	hsa-miR-4800-5p	CLIP-seq
MIRT2473362	hsa-miR-488	CLIP-seq
MIRT778836	hsa-miR-508-5p	CLIP-seq
MIRT1929890	hsa-miR-545	CLIP-seq
MIRT2473363	hsa-miR-548ae	CLIP-seq
MIRT2473364	hsa-miR-548aj	CLIP-seq
MIRT2473365	hsa-miR-548am	CLIP-seq
MIRT778840	hsa-miR-548p	CLIP-seq
MIRT2473366	hsa-miR-548u	CLIP-seq
MIRT2473367	hsa-miR-548x	CLIP-seq
MIRT778841	hsa-miR-556-5p	CLIP-seq
MIRT2473368	hsa-miR-570	CLIP-seq
MIRT2170690	hsa-miR-587	CLIP-seq
MIRT778842	hsa-miR-588	CLIP-seq
MIRT2473369	hsa-miR-589	CLIP-seq
MIRT2473370	hsa-miR-590-3p	CLIP-seq
MIRT2473371	hsa-miR-595	CLIP-seq
MIRT1929891	hsa-miR-604	CLIP-seq
MIRT2473372	hsa-miR-625	CLIP-seq
MIRT1929893	hsa-miR-634	CLIP-seq
MIRT2473373	hsa-miR-641	CLIP-seq
MIRT1929894	hsa-miR-647	CLIP-seq
MIRT2473374	hsa-miR-648	CLIP-seq
MIRT1929897	hsa-miR-761	CLIP-seq
MIRT778843	hsa-miR-766	CLIP-seq
MIRT2473375	hsa-miR-767-3p	CLIP-seq
MIRT2473376	hsa-miR-888	CLIP-seq
MIRT778845	hsa-miR-892b	CLIP-seq
MIRT778846	hsa-miR-922	CLIP-seq
MIRT1929856	hsa-miR-1185	CLIP-seq
MIRT778797	hsa-miR-1193	CLIP-seq
MIRT2473322	hsa-miR-1208	CLIP-seq
MIRT1929859	hsa-miR-1255a	CLIP-seq
MIRT1929860	hsa-miR-1255b	CLIP-seq
MIRT778798	hsa-miR-1268	CLIP-seq
MIRT778799	hsa-miR-1268b	CLIP-seq
MIRT2473323	hsa-miR-129-5p	CLIP-seq
MIRT778802	hsa-miR-1909	CLIP-seq
MIRT778803	hsa-miR-193b	CLIP-seq
MIRT1929863	hsa-miR-214	CLIP-seq
MIRT1929864	hsa-miR-31	CLIP-seq
MIRT1929865	hsa-miR-3136-3p	CLIP-seq
MIRT2674907	hsa-miR-3140-3p	CLIP-seq
MIRT1929867	hsa-miR-3161	CLIP-seq
MIRT2473329	hsa-miR-3194-3p	CLIP-seq
MIRT778810	hsa-miR-3200-3p	CLIP-seq
MIRT778811	hsa-miR-3200-5p	CLIP-seq
MIRT1929869	hsa-miR-320e	CLIP-seq
MIRT2473330	hsa-miR-338-3p	CLIP-seq
MIRT1929870	hsa-miR-34b	CLIP-seq
MIRT1929871	hsa-miR-3605-5p	CLIP-seq
MIRT2473331	hsa-miR-3613-3p	CLIP-seq
MIRT2473332	hsa-miR-3617	CLIP-seq
MIRT1929873	hsa-miR-3619-5p	CLIP-seq
MIRT1929875	hsa-miR-3679-5p	CLIP-seq
MIRT2473333	hsa-miR-3681	CLIP-seq
MIRT2473334	hsa-miR-3688-5p	CLIP-seq
MIRT778812	hsa-miR-3691-5p	CLIP-seq
MIRT1929876	hsa-miR-371b-5p	CLIP-seq
MIRT1929878	hsa-miR-3943	CLIP-seq
MIRT2473336	hsa-miR-4286	CLIP-seq
MIRT1929879	hsa-miR-4291	CLIP-seq
MIRT778816	hsa-miR-4297	CLIP-seq
MIRT1929881	hsa-miR-4323	CLIP-seq
MIRT778818	hsa-miR-4327	CLIP-seq
MIRT2473338	hsa-miR-4426	CLIP-seq
MIRT1929883	hsa-miR-4436a	CLIP-seq
MIRT2473339	hsa-miR-4481	CLIP-seq
MIRT2473340	hsa-miR-4503	CLIP-seq
MIRT2473341	hsa-miR-4509	CLIP-seq
MIRT2473343	hsa-miR-452	CLIP-seq
MIRT2473344	hsa-miR-4530	CLIP-seq
MIRT2473345	hsa-miR-4645-5p	CLIP-seq
MIRT2473346	hsa-miR-4647	CLIP-seq
MIRT2473347	hsa-miR-4662b	CLIP-seq
MIRT2473348	hsa-miR-4668-5p	CLIP-seq
MIRT2473349	hsa-miR-4673	CLIP-seq
MIRT2473350	hsa-miR-4676-3p	CLIP-seq
MIRT2473351	hsa-miR-4682	CLIP-seq
MIRT1929885	hsa-miR-4690-3p	CLIP-seq
MIRT778828	hsa-miR-4701-5p	CLIP-seq
MIRT2473352	hsa-miR-4711-5p	CLIP-seq
MIRT2473354	hsa-miR-4716-3p	CLIP-seq
MIRT2473355	hsa-miR-4724-3p	CLIP-seq
MIRT2473356	hsa-miR-4742-5p	CLIP-seq
MIRT2473357	hsa-miR-4745-5p	CLIP-seq
MIRT1929887	hsa-miR-4749-3p	CLIP-seq
MIRT1929888	hsa-miR-4758-3p	CLIP-seq
MIRT2473358	hsa-miR-4758-5p	CLIP-seq
MIRT778830	hsa-miR-4766-5p	CLIP-seq
MIRT778831	hsa-miR-4768-3p	CLIP-seq
MIRT2473359	hsa-miR-4775	CLIP-seq
MIRT778833	hsa-miR-4777-5p	CLIP-seq
MIRT2170680	hsa-miR-4793-3p	CLIP-seq
MIRT2473360	hsa-miR-4795-3p	CLIP-seq
MIRT2473362	hsa-miR-488	CLIP-seq
MIRT778836	hsa-miR-508-5p	CLIP-seq
MIRT1929890	hsa-miR-545	CLIP-seq
MIRT2473363	hsa-miR-548ae	CLIP-seq
MIRT2473364	hsa-miR-548aj	CLIP-seq
MIRT2473365	hsa-miR-548am	CLIP-seq
MIRT778840	hsa-miR-548p	CLIP-seq
MIRT2473366	hsa-miR-548u	CLIP-seq
MIRT2473367	hsa-miR-548x	CLIP-seq
MIRT778841	hsa-miR-556-5p	CLIP-seq
MIRT2473368	hsa-miR-570	CLIP-seq
MIRT2170690	hsa-miR-587	CLIP-seq
MIRT778842	hsa-miR-588	CLIP-seq
MIRT2473370	hsa-miR-590-3p	CLIP-seq
MIRT2473371	hsa-miR-595	CLIP-seq
MIRT1929891	hsa-miR-604	CLIP-seq
MIRT2473372	hsa-miR-625	CLIP-seq
MIRT1929893	hsa-miR-634	CLIP-seq
MIRT2473373	hsa-miR-641	CLIP-seq
MIRT1929894	hsa-miR-647	CLIP-seq
MIRT2473374	hsa-miR-648	CLIP-seq
MIRT1929897	hsa-miR-761	CLIP-seq
MIRT778843	hsa-miR-766	CLIP-seq
MIRT2473375	hsa-miR-767-3p	CLIP-seq
MIRT2473376	hsa-miR-888	CLIP-seq
MIRT778845	hsa-miR-892b	CLIP-seq
MIRT778846	hsa-miR-922	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IDA	21264265
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21264265
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006397	Process	MRNA processing	IEA
GO:0006417	Process	Regulation of translation	IDA	36944332
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0010793	Process	Regulation of mRNA export from nucleus	IMP	23177736
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016607	Component	Nuclear speck	IDA	23177736
GO:0016607	Component	Nuclear speck	IEA
GO:0016706	Function	2-oxoglutarate-dependent dioxygenase activity	IDA	21264265
GO:0030154	Process	Cell differentiation	IEA
GO:0035515	Function	Oxidative RNA demethylase activity	IBA
GO:0035515	Function	Oxidative RNA demethylase activity	IEA
GO:0042382	Component	Paraspeckles	IDA	37474102
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0046630	Process	Gamma-delta T cell proliferation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050684	Process	Regulation of mRNA processing	IMP	23177736
GO:0051213	Function	Dioxygenase activity	IEA
GO:0061157	Process	MRNA destabilization	IDA	34048572, 37257451
GO:0061157	Process	MRNA destabilization	IEA
GO:0061157	Process	MRNA destabilization	ISS
GO:0140693	Function	Molecular condensate scaffold activity	IDA	37474102
GO:0140694	Process	Membraneless organelle assembly	IDA	37474102
GO:1990931	Function	MRNA N6-methyladenosine dioxygenase activity	IDA	23177736, 24616105, 34048572, 35333330, 36944332, 37257451, 37369679, 37474102
GO:1990931	Function	MRNA N6-methyladenosine dioxygenase activity	IEA

MIM	HGNC	e!Ensembl
613303	25996	ENSG00000091542

Q6P6C2

Protein name

RNA demethylase ALKBH5 (EC 1.14.11.53) (Alkylated DNA repair protein alkB homolog 5) (Alpha-ketoglutarate-dependent dioxygenase alkB homolog 5)

Protein function

Dioxygenase that specifically demethylates N(6)-methyladenosine (m6A) RNA, the most prevalent internal modification of messenger RNA (mRNA) in higher eukaryotes (PubMed:23177736, PubMed:24489119, PubMed:24616105, PubMed:24778178, PubMed:34048572

PDB

4NJ4 , 4NRM , 4NRO , 4NRP , 4NRQ , 4O61 , 4O7X , 4OCT , 7V4G , 7WKV , 7WL0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13532	2OG-FeII_Oxy_2	93 → 297	2OG-Fe(II) oxygenase superfamily	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with highest expression in lung, followed by testis, pancreas, spleen and ovary. {ECO:0000269|PubMed:17979886}.

Sequence

MAAASGYTDLREKLKSMTSRDNYKAGSREAAAAAAAAVAAAAAAAAAAEPYPVSGAKRKY
QEDSDPERSDYEEQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYN
EHTVDRAPLRNKYFFGEGYTYGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHR
VIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVS
EPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRLETKSLSSS
VLPPSYASDRLSGNNRDPALKPKRSHRKADPDAAHRPRILEMDKEENRRSVLLPTHRRRG
SFSSENYWRKSYESSEDCSEAAGSPARKVKMRRH

Sequence length

394

Interactions

View interactions

	Reactome
			Reversal of alkylation damage by DNA dioxygenases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRE-ECLAMPSIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (83)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31677788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32884942	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	40225569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32402250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27001847, 27590511, 29040886, 30953473, 30987661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27001847, 30953473, 32402250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32402250, 34759347, 35318440, 36239338, 37480971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34221187, 34647424, 35982895, 36335087, 36419136, 38501918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	36632222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38164857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30987661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36123506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31506804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	31823961	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32596399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31396313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32567849, 32747553, 37203239, 37381158, 37416772, 38479704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	33350853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34347888, 40064293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30987661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36159855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34876920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	32685056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28344040, 29040886, 30987661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28399407, 32439916, 36239338, 37979586, 39216042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28344040, 29040886, 30987661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34432221, 36123877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27001847, 36632222	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37149664, 37885015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27590511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	26820768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Female	Female infertility	Pubtator	37848452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35340126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	37175660	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	32619516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32402250, 32619516, 35579750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34016959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32583611, 32685056	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35114989	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36632222	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	26047305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27001847, 27590511, 29040886, 30953473, 30987661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30032148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27358489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31290116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30306128, 30953473, 31506804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31506804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32567849, 32747553, 38252669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	31281518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34759347	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	35414790	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30870073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	33108260	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27001847, 29040886, 29904125, 31506804, 31823961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29904125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34950106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	39379688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33431791, 35303054, 35490460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36632222, 37272931, 37684273, 38098223, 39511642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30032148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30032148	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34055982, 37149664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37858219	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27358489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27358489, 32710725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36814156	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33370249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	39287046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	36203590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34758859, 34802443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31519943, 34850551, 35689537, 36990154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29842885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31290116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31290116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35114989	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	34650160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36851875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36851875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38104484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35048498	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36028854, 36091006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37480971	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	32091154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ALKBH5 (alkB homolog 5, RNA demethylase)