Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	54879
Gene name	Suppression of tumorigenicity 7 like
Gene symbol	ST7L
Synonyms (NCBI Gene)	FAM4BST7RSTLR
Chromosome	1
Chromosome location	1p13.2
Summary	This gene was identified by its similarity to the ST7 tumor suppressor gene found in the chromosome 7q31 region. This gene is clustered in a tail-to-tail manner with the WNT2B gene in a chromosomal region known to be deleted and rearranged in a variety of

114

Show/Hide all (114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007215	hsa-miR-24-3p	Luciferase reporter assayqRT-PCRWestern blot	23142218
MIRT007215	hsa-miR-24-3p	Luciferase reporter assayqRT-PCRWestern blot	23142218
MIRT040824	hsa-miR-18a-3p	CLASH	23622248
MIRT488594	hsa-miR-1321	PAR-CLIP	23592263
MIRT488593	hsa-miR-4739	PAR-CLIP	23592263
MIRT488591	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT488592	hsa-miR-4270	PAR-CLIP	23592263
MIRT488590	hsa-miR-4441	PAR-CLIP	23592263
MIRT488589	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT488588	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT488587	hsa-miR-7515	PAR-CLIP	23592263
MIRT488586	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT488584	hsa-miR-7154-3p	PAR-CLIP	23592263
MIRT488585	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT488583	hsa-miR-3180	PAR-CLIP	23592263
MIRT488582	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT488581	hsa-miR-3196	PAR-CLIP	23592263
MIRT488580	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT488594	hsa-miR-1321	PAR-CLIP	23592263
MIRT488593	hsa-miR-4739	PAR-CLIP	23592263
MIRT488591	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT488592	hsa-miR-4270	PAR-CLIP	23592263
MIRT488590	hsa-miR-4441	PAR-CLIP	23592263
MIRT488589	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT488588	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT488587	hsa-miR-7515	PAR-CLIP	23592263
MIRT488586	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT488584	hsa-miR-7154-3p	PAR-CLIP	23592263
MIRT488585	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT488583	hsa-miR-3180	PAR-CLIP	23592263
MIRT488582	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT488581	hsa-miR-3196	PAR-CLIP	23592263
MIRT488580	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT1393822	hsa-miR-3123	CLIP-seq
MIRT1393823	hsa-miR-3177-5p	CLIP-seq
MIRT1393824	hsa-miR-329	CLIP-seq
MIRT1393825	hsa-miR-362-3p	CLIP-seq
MIRT1393826	hsa-miR-376c	CLIP-seq
MIRT1393827	hsa-miR-3925-5p	CLIP-seq
MIRT1393828	hsa-miR-3941	CLIP-seq
MIRT1393829	hsa-miR-3976	CLIP-seq
MIRT1393830	hsa-miR-466	CLIP-seq
MIRT1393831	hsa-miR-4672	CLIP-seq
MIRT1393832	hsa-miR-4789-3p	CLIP-seq
MIRT1393833	hsa-miR-603	CLIP-seq
MIRT1393834	hsa-miR-642b	CLIP-seq
MIRT1393835	hsa-miR-1238	CLIP-seq
MIRT1393836	hsa-miR-1290	CLIP-seq
MIRT1393837	hsa-miR-3159	CLIP-seq
MIRT1393838	hsa-miR-4264	CLIP-seq
MIRT1393839	hsa-miR-622	CLIP-seq
MIRT1393840	hsa-miR-651	CLIP-seq
MIRT1393841	hsa-miR-1273f	CLIP-seq
MIRT1393842	hsa-miR-383	CLIP-seq
MIRT1393843	hsa-miR-3919	CLIP-seq
MIRT1393844	hsa-miR-4514	CLIP-seq
MIRT1393845	hsa-miR-4692	CLIP-seq
MIRT1393846	hsa-miR-4756-3p	CLIP-seq
MIRT1393847	hsa-miR-4775	CLIP-seq
MIRT1393848	hsa-miR-578	CLIP-seq
MIRT1393849	hsa-miR-581	CLIP-seq
MIRT1393847	hsa-miR-4775	CLIP-seq
MIRT1393847	hsa-miR-4775	CLIP-seq
MIRT2634157	hsa-miR-1206	CLIP-seq
MIRT2634158	hsa-miR-1266	CLIP-seq
MIRT1393841	hsa-miR-1273f	CLIP-seq
MIRT2634159	hsa-miR-143	CLIP-seq
MIRT2634160	hsa-miR-146a	CLIP-seq
MIRT2634161	hsa-miR-146b-5p	CLIP-seq
MIRT2634162	hsa-miR-153	CLIP-seq
MIRT2634163	hsa-miR-2467-3p	CLIP-seq
MIRT2634164	hsa-miR-298	CLIP-seq
MIRT1393822	hsa-miR-3123	CLIP-seq
MIRT2634165	hsa-miR-3134	CLIP-seq
MIRT2634166	hsa-miR-3155	CLIP-seq
MIRT2634167	hsa-miR-3155b	CLIP-seq
MIRT2634168	hsa-miR-3158-5p	CLIP-seq
MIRT2634169	hsa-miR-3174	CLIP-seq
MIRT2634170	hsa-miR-331-3p	CLIP-seq
MIRT2634171	hsa-miR-3605-3p	CLIP-seq
MIRT2634172	hsa-miR-3646	CLIP-seq
MIRT2634173	hsa-miR-3664-3p	CLIP-seq
MIRT2634174	hsa-miR-3672	CLIP-seq
MIRT2634175	hsa-miR-3678-3p	CLIP-seq
MIRT1393826	hsa-miR-376c	CLIP-seq
MIRT1393827	hsa-miR-3925-5p	CLIP-seq
MIRT1393829	hsa-miR-3976	CLIP-seq
MIRT2634176	hsa-miR-4251	CLIP-seq
MIRT2634177	hsa-miR-4292	CLIP-seq
MIRT2634178	hsa-miR-4313	CLIP-seq
MIRT2634179	hsa-miR-4518	CLIP-seq
MIRT2634180	hsa-miR-4534	CLIP-seq
MIRT2634181	hsa-miR-455-5p	CLIP-seq
MIRT2634182	hsa-miR-4632	CLIP-seq
MIRT2634183	hsa-miR-4663	CLIP-seq
MIRT2634184	hsa-miR-4708-3p	CLIP-seq
MIRT2634185	hsa-miR-4708-5p	CLIP-seq
MIRT1393846	hsa-miR-4756-3p	CLIP-seq
MIRT2634186	hsa-miR-4768-5p	CLIP-seq
MIRT2634187	hsa-miR-4770	CLIP-seq
MIRT1393832	hsa-miR-4789-3p	CLIP-seq
MIRT2634188	hsa-miR-4793-5p	CLIP-seq
MIRT2634189	hsa-miR-4797-5p	CLIP-seq
MIRT2634190	hsa-miR-484	CLIP-seq
MIRT2634191	hsa-miR-568	CLIP-seq
MIRT2634192	hsa-miR-576-3p	CLIP-seq
MIRT2634193	hsa-miR-580	CLIP-seq
MIRT1393834	hsa-miR-642b	CLIP-seq
MIRT2634194	hsa-miR-767-3p	CLIP-seq
MIRT2634195	hsa-miR-921	CLIP-seq
MIRT2634196	hsa-miR-942	CLIP-seq
MIRT2634174	hsa-miR-3672	CLIP-seq
MIRT2634184	hsa-miR-4708-3p	CLIP-seq
MIRT2634191	hsa-miR-568	CLIP-seq

Show/Hide all (3)

GO ID	Ontology	Definition	Evidence
GO:0016020	Component	Membrane	IEA
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030308	Process	Negative regulation of cell growth	ISS

MIM	HGNC	e!Ensembl
617640	18441	ENSG00000007341

Q8TDW4

Protein name

Suppressor of tumorigenicity 7 protein-like (ST7-related protein)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04184	ST7	38 → 555	ST7 protein	Family

Sequence

MADRGGVGEAAAVGASPASVPGLNPTLGWRERLRAGLAGTGASLWFVAGLGLLYALRIPL
RLCENLAAVTVFLNSLTPKFYVALTGTSSLISGLIFIFEWWYFHKHGTSFIEQVSVSHLQ
PLMGGTESSISEPGSPSRNRENETSRQNLSECKVWRNPLNLFRGAEYRRYTWVTGKEPLT
YYDMNLSAQDHQTFFTCDTDFLRPSDTVMQKAWRERNPPARIKAAYQALELNNDCATAYV
LLAEEEATTIVDAERLFKQALKAGETIYRQSQQCQHQSPQHEAQLRRDTNVLVYIKRRLA
MCARKLGRIREAVKIMRDLMKEFPPLTMLNIHENLLESLLELQAYPDVQAVLAKYDDISL
PKSAAICYTAALLKTRTVSEKFSPETASRRGLSTAEINAVEAIHRAVEFNPHVPKYLLEM
KSLILPPEHILKRGDSEAIAYAFFHLQHWKRIEGALNLLQCTWEGTFRMIPYPLEKGHLF
YPYPSCTETADRELLPTFHHVSVYPKKELPLFIHFTAGFCSSTAMIAILTHQFPEIMGIF
AKAVLGLWCPQPWASSGFEENTQDLKSEDLGLSSG

Sequence length

575

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	31429477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27537390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27537390		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28902356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28902356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27537390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28518144, 30176933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31429477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29850766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12063568, 27537390, 28902356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28902356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12063568, 31429477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29850766		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	32924881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ST7L (suppression of tumorigenicity 7 like)