TENT5C (terminal nucleotidyltransferase 5C)

Gene

• Entrez ID: 54855
• Gene name: Terminal nucleotidyltransferase 5C
• Gene symbol: TENT5C
• Synonyms (NCBI Gene): FAM46C
• Chromosome: 1
• Chromosome location: 1p12

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT733890	hsa-miR-657	ELISA, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blotting	31915414
MIRT756006	hsa-miR-4668-5p	Luciferase reporter assay, qRT-PCR	37035757

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001701	Process	In utero embryonic development	IEA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28931820, 32433990
GO:0005634	Component	Nucleus	IDA	28931820
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	28931820
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	32433990
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IMP	32433990
GO:0048255	Process	MRNA stabilization	IBA
GO:0048255	Process	MRNA stabilization	IDA	28931820
GO:0048255	Process	MRNA stabilization	IEA
GO:1990817	Function	Poly(A) RNA polymerase activity	IBA
GO:1990817	Function	Poly(A) RNA polymerase activity	IDA	28931820, 32009146
GO:1990817	Function	Poly(A) RNA polymerase activity	IEA

Other IDs

• MIM: 613952
• HGNC: 24712
• e!Ensembl: ENSG00000183508

Protein

• UniProt ID: Q5VWP2
• Protein name: Terminal nucleotidyltransferase 5C (EC 2.7.7.19) (Non-canonical poly(A) polymerase FAM46C)
• Protein function: Catalyzes the transfer of one adenosine molecule from an ATP to an mRNA poly(A) tail bearing a 3'-OH terminal group and enhances mRNA stability and gene expression (PubMed:28931820, PubMed:32009146, PubMed:34048638). Can also elongate RNA oligos
• PDB: 6W36, 6W38, 6W3I, 6W3J, 8EQB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07984	NTP_transf_7	17 → 336	Nucleotidyltransferase	Domain

• Sequence:

  MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLE
  EAGIKVHDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFL
  PEGVNKLKISPVTLKEAYVQKLVKVCTDTDRWSLISLSNKNGKNVELKFVDSIRRQFEFS
  VDSFQIILDSLLFFYDCSNNPISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIR
  GGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEE
  RSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSATNVTCYYQPA
  PYVSDGNFSNYYVAHPPVTYSQPYPTWLPCN

• Sequence length: 391

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CATARACT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autoimmune Diseases	Autoimmune disease	Pubtator	36267464	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32468032	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35276058	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32468032	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28341836, 29230037		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	30573978		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27770343, 31585903		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28123642, 28619709		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	27060136	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	28619709	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21994415, 27060136, 28341836, 28619709, 28931820, 30573978		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21994415, 24434212, 25743686, 26282654, 27060136, 28619709, 29563506, 29884741, 30809292, 32433990, 33338886, 33436579, 37031341, 37452600	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	32141701	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	38218802	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27770343, 28341836, 30573978, 31585903		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	36267464	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	38218802	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30910647		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30573978		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27770343, 31585903		★☆☆☆☆ Found in Text Mining only