Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54848
Gene name	Rho guanine nucleotide exchange factor 38
Gene symbol	ARHGEF38
Synonyms (NCBI Gene)	-
Chromosome	4
Chromosome location	4q24

100

Show/Hide all (100)

miRTarBase ID	miRNA	Experiments
MIRT795865	hsa-miR-101	CLIP-seq
MIRT795866	hsa-miR-1200	CLIP-seq
MIRT795867	hsa-miR-1273f	CLIP-seq
MIRT795868	hsa-miR-1297	CLIP-seq
MIRT795869	hsa-miR-139-5p	CLIP-seq
MIRT795870	hsa-miR-143	CLIP-seq
MIRT795871	hsa-miR-144	CLIP-seq
MIRT795872	hsa-miR-192	CLIP-seq
MIRT795873	hsa-miR-205	CLIP-seq
MIRT795874	hsa-miR-215	CLIP-seq
MIRT795875	hsa-miR-2355-5p	CLIP-seq
MIRT795876	hsa-miR-26a	CLIP-seq
MIRT795877	hsa-miR-26b	CLIP-seq
MIRT795878	hsa-miR-2964a-5p	CLIP-seq
MIRT795879	hsa-miR-3121-3p	CLIP-seq
MIRT795880	hsa-miR-3130-5p	CLIP-seq
MIRT795881	hsa-miR-3137	CLIP-seq
MIRT795882	hsa-miR-3140-5p	CLIP-seq
MIRT795883	hsa-miR-3156-5p	CLIP-seq
MIRT795884	hsa-miR-3160-5p	CLIP-seq
MIRT795885	hsa-miR-3618	CLIP-seq
MIRT795886	hsa-miR-3663-5p	CLIP-seq
MIRT795887	hsa-miR-3679-3p	CLIP-seq
MIRT795888	hsa-miR-3681	CLIP-seq
MIRT795889	hsa-miR-3686	CLIP-seq
MIRT795890	hsa-miR-412	CLIP-seq
MIRT795891	hsa-miR-4257	CLIP-seq
MIRT795892	hsa-miR-4286	CLIP-seq
MIRT795893	hsa-miR-4301	CLIP-seq
MIRT795894	hsa-miR-4307	CLIP-seq
MIRT795895	hsa-miR-4328	CLIP-seq
MIRT795896	hsa-miR-4446-5p	CLIP-seq
MIRT795897	hsa-miR-4465	CLIP-seq
MIRT795898	hsa-miR-4476	CLIP-seq
MIRT795899	hsa-miR-4482	CLIP-seq
MIRT795900	hsa-miR-4520a-3p	CLIP-seq
MIRT795901	hsa-miR-4520b-3p	CLIP-seq
MIRT795902	hsa-miR-4529-3p	CLIP-seq
MIRT795903	hsa-miR-4652-3p	CLIP-seq
MIRT795904	hsa-miR-4703-3p	CLIP-seq
MIRT795905	hsa-miR-4708-5p	CLIP-seq
MIRT795906	hsa-miR-4712-5p	CLIP-seq
MIRT795907	hsa-miR-4770	CLIP-seq
MIRT795908	hsa-miR-486-5p	CLIP-seq
MIRT795909	hsa-miR-561	CLIP-seq
MIRT795910	hsa-miR-570	CLIP-seq
MIRT795911	hsa-miR-578	CLIP-seq
MIRT795912	hsa-miR-770-5p	CLIP-seq
MIRT795913	hsa-miR-3119	CLIP-seq
MIRT795914	hsa-miR-3188	CLIP-seq
MIRT795915	hsa-miR-3653	CLIP-seq
MIRT795916	hsa-miR-3658	CLIP-seq
MIRT795917	hsa-miR-3692	CLIP-seq
MIRT795918	hsa-miR-4659a-3p	CLIP-seq
MIRT795919	hsa-miR-4659b-3p	CLIP-seq
MIRT2175007	hsa-miR-3127-5p	CLIP-seq
MIRT2175008	hsa-miR-3128	CLIP-seq
MIRT2175009	hsa-miR-3158-3p	CLIP-seq
MIRT2175010	hsa-miR-3622b-5p	CLIP-seq
MIRT2175011	hsa-miR-3918	CLIP-seq
MIRT2175012	hsa-miR-4716-5p	CLIP-seq
MIRT2175013	hsa-miR-4720-5p	CLIP-seq
MIRT2175014	hsa-miR-4799-3p	CLIP-seq
MIRT2384438	hsa-miR-202	CLIP-seq
MIRT2384439	hsa-miR-450b-5p	CLIP-seq
MIRT2384440	hsa-miR-518a-5p	CLIP-seq
MIRT2384441	hsa-miR-527	CLIP-seq
MIRT2443946	hsa-miR-1207-3p	CLIP-seq
MIRT2443947	hsa-miR-1265	CLIP-seq
MIRT2443948	hsa-miR-1299	CLIP-seq
MIRT2443949	hsa-miR-3125	CLIP-seq
MIRT2443950	hsa-miR-3148	CLIP-seq
MIRT2443951	hsa-miR-3916	CLIP-seq
MIRT2443952	hsa-miR-3978	CLIP-seq
MIRT2443953	hsa-miR-4493	CLIP-seq
MIRT2443954	hsa-miR-4522	CLIP-seq
MIRT2443955	hsa-miR-4700-3p	CLIP-seq
MIRT2443956	hsa-miR-548n	CLIP-seq
MIRT2443957	hsa-miR-548t	CLIP-seq
MIRT2443958	hsa-miR-875-3p	CLIP-seq
MIRT2443959	hsa-miR-877	CLIP-seq
MIRT2443947	hsa-miR-1265	CLIP-seq
MIRT2443948	hsa-miR-1299	CLIP-seq
MIRT2443949	hsa-miR-3125	CLIP-seq
MIRT2443951	hsa-miR-3916	CLIP-seq
MIRT2443952	hsa-miR-3978	CLIP-seq
MIRT2443954	hsa-miR-4522	CLIP-seq
MIRT2443955	hsa-miR-4700-3p	CLIP-seq
MIRT2443958	hsa-miR-875-3p	CLIP-seq
MIRT2443959	hsa-miR-877	CLIP-seq
MIRT2443948	hsa-miR-1299	CLIP-seq
MIRT2443949	hsa-miR-3125	CLIP-seq
MIRT2478212	hsa-miR-3149	CLIP-seq
MIRT2443951	hsa-miR-3916	CLIP-seq
MIRT2443952	hsa-miR-3978	CLIP-seq
MIRT795894	hsa-miR-4307	CLIP-seq
MIRT2443954	hsa-miR-4522	CLIP-seq
MIRT2478213	hsa-miR-568	CLIP-seq
MIRT2443958	hsa-miR-875-3p	CLIP-seq
MIRT2443959	hsa-miR-877	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA

MIM	HGNC	e!Ensembl
619919	25968	ENSG00000236699

Q9NXL2

Protein name

Rho guanine nucleotide exchange factor 38

Protein function

May act as a guanine-nucleotide releasing factor.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00621	RhoGEF	98 → 283	RhoGEF domain	Domain
PF07653	SH3_2	586 → 643	Variant SH3 domain	Domain
PF14604	SH3_9	720 → 772	Variant SH3 domain	Domain

Sequence

MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEY
NQKLQEKMTPQGECSVAETLTPEEEHHMKRMMAKREKIIKELIQTEKDYLNDLELCVREV
VQPLRNKKTDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPL
EDIYKIYCYHHDEAHSILESYEKEEELKEHLSHCIQSLKKIYMQEGKPNLLDMGSLMIKP
IQRVMKYPLLLCELRNSTPPSHPDYRALDDAFAAVKDINVNINELKRRKDLVLKYKKNDE
DESLKDKLSKLNIHSISKKSKRVTNHLKILTRGESQVKDNTFNREEKLFRALEKTVRLCV
KNISLCLQHIQDAMPLALQSVMDLQEISYNKDDEMDYSETLSNALNSCHDFASHLQRLIL
TPLSALLSLFPGPHKLIQKRYDKLLDCNSYLQRSTGEESDLAKKEYEALNAQLVEELQAF
NQAARKILLNCLCSFITLLRDLMLVAQQAYSTLVPMPLLVSSISEIQNQVLEEIQNLNCV
KENSATFIERKLSFEKKKPVQILPEMPHQTDIHRSKLLSTYSAEELYQAKRKCNATQEYD
INLLEGDLVAVIEQKDPLGSTSRWLVDTGNVKGYVYSSFLKPYNPAKMQKVDAENRFCDD
DFENISLFVSSRPASDSVTGTSESSIGDSSSSLSGTCGKFETNGTDVDSFQEVDEQIFYA
VHAFQARSDHELSLQEYQRVHILRFCDLSGNKEWWLAEAQGQKGYVPANYLGKMTYA

Sequence length

777

Interactions

View interactions

	Reactome
			NRAGE signals death through JNK Rho GTPase cycle G alpha (12/13) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE WITH CLEFT LIP	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21659657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	28166215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	36493769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	36493769	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

ARHGEF38 (Rho guanine nucleotide exchange factor 38)