Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	54828
Gene name	BCAS3 microtubule associated cell migration factor
Gene symbol	BCAS3
Synonyms (NCBI Gene)	GAOB1HEMARSMAABPHAF2
Chromosome	17
Chromosome location	17q23.2

218

Show/Hide all (218)

miRTarBase ID	miRNA	Experiments
MIRT817669	hsa-miR-1184	CLIP-seq
MIRT817670	hsa-miR-1236	CLIP-seq
MIRT817671	hsa-miR-1252	CLIP-seq
MIRT817672	hsa-miR-1265	CLIP-seq
MIRT817673	hsa-miR-1266	CLIP-seq
MIRT817674	hsa-miR-1273g	CLIP-seq
MIRT817675	hsa-miR-127-3p	CLIP-seq
MIRT817676	hsa-miR-1286	CLIP-seq
MIRT817677	hsa-miR-1305	CLIP-seq
MIRT817678	hsa-miR-138	CLIP-seq
MIRT817679	hsa-miR-1909	CLIP-seq
MIRT817680	hsa-miR-205	CLIP-seq
MIRT817681	hsa-miR-2110	CLIP-seq
MIRT817682	hsa-miR-214	CLIP-seq
MIRT817683	hsa-miR-2278	CLIP-seq
MIRT817684	hsa-miR-2467-5p	CLIP-seq
MIRT817685	hsa-miR-3150a-3p	CLIP-seq
MIRT817686	hsa-miR-3151	CLIP-seq
MIRT817687	hsa-miR-3153	CLIP-seq
MIRT817688	hsa-miR-3160-3p	CLIP-seq
MIRT817689	hsa-miR-3173-3p	CLIP-seq
MIRT817690	hsa-miR-3179	CLIP-seq
MIRT817691	hsa-miR-3185	CLIP-seq
MIRT817692	hsa-miR-3188	CLIP-seq
MIRT817693	hsa-miR-320e	CLIP-seq
MIRT817694	hsa-miR-338-3p	CLIP-seq
MIRT817695	hsa-miR-34a	CLIP-seq
MIRT817696	hsa-miR-34c-5p	CLIP-seq
MIRT817697	hsa-miR-3619-5p	CLIP-seq
MIRT817698	hsa-miR-383	CLIP-seq
MIRT817699	hsa-miR-3909	CLIP-seq
MIRT817700	hsa-miR-3918	CLIP-seq
MIRT817701	hsa-miR-3975	CLIP-seq
MIRT817702	hsa-miR-421	CLIP-seq
MIRT817703	hsa-miR-4271	CLIP-seq
MIRT817704	hsa-miR-4283	CLIP-seq
MIRT817705	hsa-miR-4286	CLIP-seq
MIRT817706	hsa-miR-4287	CLIP-seq
MIRT817707	hsa-miR-4302	CLIP-seq
MIRT817708	hsa-miR-4325	CLIP-seq
MIRT817709	hsa-miR-4418	CLIP-seq
MIRT817710	hsa-miR-4420	CLIP-seq
MIRT817711	hsa-miR-4435	CLIP-seq
MIRT817712	hsa-miR-4453	CLIP-seq
MIRT817713	hsa-miR-4468	CLIP-seq
MIRT817714	hsa-miR-4487	CLIP-seq
MIRT817715	hsa-miR-4488	CLIP-seq
MIRT817716	hsa-miR-4489	CLIP-seq
MIRT817717	hsa-miR-4492	CLIP-seq
MIRT817718	hsa-miR-4498	CLIP-seq
MIRT817719	hsa-miR-4499	CLIP-seq
MIRT817720	hsa-miR-449a	CLIP-seq
MIRT817721	hsa-miR-449b	CLIP-seq
MIRT817722	hsa-miR-4508	CLIP-seq
MIRT817723	hsa-miR-4512	CLIP-seq
MIRT817724	hsa-miR-4518	CLIP-seq
MIRT817725	hsa-miR-4520a-3p	CLIP-seq
MIRT817726	hsa-miR-4520b-3p	CLIP-seq
MIRT817727	hsa-miR-4530	CLIP-seq
MIRT817728	hsa-miR-4538	CLIP-seq
MIRT817729	hsa-miR-4649-3p	CLIP-seq
MIRT817730	hsa-miR-4656	CLIP-seq
MIRT817731	hsa-miR-4667-3p	CLIP-seq
MIRT817732	hsa-miR-4672	CLIP-seq
MIRT817733	hsa-miR-4685-3p	CLIP-seq
MIRT817734	hsa-miR-4691-5p	CLIP-seq
MIRT817735	hsa-miR-4697-5p	CLIP-seq
MIRT817736	hsa-miR-4698	CLIP-seq
MIRT817737	hsa-miR-4700-3p	CLIP-seq
MIRT817738	hsa-miR-4709-5p	CLIP-seq
MIRT817739	hsa-miR-4713-5p	CLIP-seq
MIRT817740	hsa-miR-4722-5p	CLIP-seq
MIRT817741	hsa-miR-4725-3p	CLIP-seq
MIRT817742	hsa-miR-4728-5p	CLIP-seq
MIRT817743	hsa-miR-4731-5p	CLIP-seq
MIRT817744	hsa-miR-4747-5p	CLIP-seq
MIRT817745	hsa-miR-4772-5p	CLIP-seq
MIRT817746	hsa-miR-4781-5p	CLIP-seq
MIRT817747	hsa-miR-4797-3p	CLIP-seq
MIRT817748	hsa-miR-485-5p	CLIP-seq
MIRT817749	hsa-miR-486-3p	CLIP-seq
MIRT817750	hsa-miR-509-3-5p	CLIP-seq
MIRT817751	hsa-miR-509-5p	CLIP-seq
MIRT817752	hsa-miR-510	CLIP-seq
MIRT817753	hsa-miR-556-5p	CLIP-seq
MIRT817754	hsa-miR-558	CLIP-seq
MIRT817755	hsa-miR-563	CLIP-seq
MIRT817756	hsa-miR-592	CLIP-seq
MIRT817757	hsa-miR-597	CLIP-seq
MIRT817758	hsa-miR-637	CLIP-seq
MIRT817759	hsa-miR-657	CLIP-seq
MIRT817760	hsa-miR-668	CLIP-seq
MIRT817761	hsa-miR-744	CLIP-seq
MIRT817762	hsa-miR-761	CLIP-seq
MIRT817763	hsa-miR-762	CLIP-seq
MIRT817764	hsa-miR-766	CLIP-seq
MIRT817765	hsa-miR-876-3p	CLIP-seq
MIRT1941752	hsa-miR-1182	CLIP-seq
MIRT817669	hsa-miR-1184	CLIP-seq
MIRT817670	hsa-miR-1236	CLIP-seq
MIRT817671	hsa-miR-1252	CLIP-seq
MIRT817672	hsa-miR-1265	CLIP-seq
MIRT817673	hsa-miR-1266	CLIP-seq
MIRT817674	hsa-miR-1273g	CLIP-seq
MIRT817675	hsa-miR-127-3p	CLIP-seq
MIRT817676	hsa-miR-1286	CLIP-seq
MIRT817677	hsa-miR-1305	CLIP-seq
MIRT1941753	hsa-miR-134	CLIP-seq
MIRT1941754	hsa-miR-136	CLIP-seq
MIRT817680	hsa-miR-205	CLIP-seq
MIRT817681	hsa-miR-2110	CLIP-seq
MIRT817683	hsa-miR-2278	CLIP-seq
MIRT817684	hsa-miR-2467-5p	CLIP-seq
MIRT1941755	hsa-miR-3118	CLIP-seq
MIRT817685	hsa-miR-3150a-3p	CLIP-seq
MIRT1941756	hsa-miR-3154	CLIP-seq
MIRT1941757	hsa-miR-3164	CLIP-seq
MIRT817692	hsa-miR-3188	CLIP-seq
MIRT817698	hsa-miR-383	CLIP-seq
MIRT817700	hsa-miR-3918	CLIP-seq
MIRT817701	hsa-miR-3975	CLIP-seq
MIRT817702	hsa-miR-421	CLIP-seq
MIRT817703	hsa-miR-4271	CLIP-seq
MIRT817708	hsa-miR-4325	CLIP-seq
MIRT817709	hsa-miR-4418	CLIP-seq
MIRT817710	hsa-miR-4420	CLIP-seq
MIRT1941758	hsa-miR-4434	CLIP-seq
MIRT817712	hsa-miR-4453	CLIP-seq
MIRT817713	hsa-miR-4468	CLIP-seq
MIRT817719	hsa-miR-4499	CLIP-seq
MIRT817723	hsa-miR-4512	CLIP-seq
MIRT1941759	hsa-miR-4516	CLIP-seq
MIRT817724	hsa-miR-4518	CLIP-seq
MIRT817725	hsa-miR-4520a-3p	CLIP-seq
MIRT817726	hsa-miR-4520b-3p	CLIP-seq
MIRT817728	hsa-miR-4538	CLIP-seq
MIRT817729	hsa-miR-4649-3p	CLIP-seq
MIRT817732	hsa-miR-4672	CLIP-seq
MIRT817738	hsa-miR-4709-5p	CLIP-seq
MIRT817740	hsa-miR-4722-5p	CLIP-seq
MIRT817741	hsa-miR-4725-3p	CLIP-seq
MIRT817744	hsa-miR-4747-5p	CLIP-seq
MIRT817745	hsa-miR-4772-5p	CLIP-seq
MIRT817747	hsa-miR-4797-3p	CLIP-seq
MIRT817748	hsa-miR-485-5p	CLIP-seq
MIRT817750	hsa-miR-509-3-5p	CLIP-seq
MIRT817751	hsa-miR-509-5p	CLIP-seq
MIRT817752	hsa-miR-510	CLIP-seq
MIRT1941760	hsa-miR-515-5p	CLIP-seq
MIRT817755	hsa-miR-563	CLIP-seq
MIRT1941761	hsa-miR-626	CLIP-seq
MIRT817760	hsa-miR-668	CLIP-seq
MIRT817765	hsa-miR-876-3p	CLIP-seq
MIRT1941762	hsa-miR-942	CLIP-seq
MIRT1941763	hsa-miR-943	CLIP-seq
MIRT817670	hsa-miR-1236	CLIP-seq
MIRT817681	hsa-miR-2110	CLIP-seq
MIRT817703	hsa-miR-4271	CLIP-seq
MIRT817741	hsa-miR-4725-3p	CLIP-seq
MIRT817671	hsa-miR-1252	CLIP-seq
MIRT817674	hsa-miR-1273g	CLIP-seq
MIRT817679	hsa-miR-1909	CLIP-seq
MIRT817681	hsa-miR-2110	CLIP-seq
MIRT817682	hsa-miR-214	CLIP-seq
MIRT817683	hsa-miR-2278	CLIP-seq
MIRT817685	hsa-miR-3150a-3p	CLIP-seq
MIRT817690	hsa-miR-3179	CLIP-seq
MIRT817694	hsa-miR-338-3p	CLIP-seq
MIRT817697	hsa-miR-3619-5p	CLIP-seq
MIRT817703	hsa-miR-4271	CLIP-seq
MIRT817712	hsa-miR-4453	CLIP-seq
MIRT817713	hsa-miR-4468	CLIP-seq
MIRT817717	hsa-miR-4492	CLIP-seq
MIRT817718	hsa-miR-4498	CLIP-seq
MIRT817719	hsa-miR-4499	CLIP-seq
MIRT817722	hsa-miR-4508	CLIP-seq
MIRT817727	hsa-miR-4530	CLIP-seq
MIRT817728	hsa-miR-4538	CLIP-seq
MIRT817731	hsa-miR-4667-3p	CLIP-seq
MIRT817734	hsa-miR-4691-5p	CLIP-seq
MIRT817739	hsa-miR-4713-5p	CLIP-seq
MIRT817741	hsa-miR-4725-3p	CLIP-seq
MIRT817742	hsa-miR-4728-5p	CLIP-seq
MIRT817744	hsa-miR-4747-5p	CLIP-seq
MIRT817746	hsa-miR-4781-5p	CLIP-seq
MIRT817755	hsa-miR-563	CLIP-seq
MIRT817760	hsa-miR-668	CLIP-seq
MIRT817761	hsa-miR-744	CLIP-seq
MIRT817762	hsa-miR-761	CLIP-seq
MIRT817763	hsa-miR-762	CLIP-seq
MIRT817764	hsa-miR-766	CLIP-seq
MIRT817765	hsa-miR-876-3p	CLIP-seq
MIRT817671	hsa-miR-1252	CLIP-seq
MIRT817674	hsa-miR-1273g	CLIP-seq
MIRT817679	hsa-miR-1909	CLIP-seq
MIRT817681	hsa-miR-2110	CLIP-seq
MIRT817682	hsa-miR-214	CLIP-seq
MIRT817683	hsa-miR-2278	CLIP-seq
MIRT817685	hsa-miR-3150a-3p	CLIP-seq
MIRT817690	hsa-miR-3179	CLIP-seq
MIRT817694	hsa-miR-338-3p	CLIP-seq
MIRT817697	hsa-miR-3619-5p	CLIP-seq
MIRT817703	hsa-miR-4271	CLIP-seq
MIRT817712	hsa-miR-4453	CLIP-seq
MIRT817713	hsa-miR-4468	CLIP-seq
MIRT817719	hsa-miR-4499	CLIP-seq
MIRT817727	hsa-miR-4530	CLIP-seq
MIRT817728	hsa-miR-4538	CLIP-seq
MIRT817731	hsa-miR-4667-3p	CLIP-seq
MIRT817734	hsa-miR-4691-5p	CLIP-seq
MIRT817741	hsa-miR-4725-3p	CLIP-seq
MIRT817742	hsa-miR-4728-5p	CLIP-seq
MIRT817744	hsa-miR-4747-5p	CLIP-seq
MIRT817755	hsa-miR-563	CLIP-seq
MIRT817760	hsa-miR-668	CLIP-seq
MIRT817762	hsa-miR-761	CLIP-seq
MIRT817764	hsa-miR-766	CLIP-seq
MIRT817765	hsa-miR-876-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MTA1	Activation	16617102

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000407	Component	Phagophore assembly site	IDA	33499712
GO:0000407	Component	Phagophore assembly site	IEA
GO:0000791	Component	Euchromatin	IDA	17505058
GO:0001525	Process	Angiogenesis	IEA
GO:0003682	Function	Chromatin binding	IDA	17505058
GO:0005515	Function	Protein binding	IPI	17505058, 22300583, 25416956, 31515488, 32296183, 33499712, 33961781
GO:0005634	Component	Nucleus	IDA	16617102, 17505058
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16617102, 17505058, 18030336
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005881	Component	Cytoplasmic microtubule	ISS
GO:0006914	Process	Autophagy	IEA
GO:0007267	Process	Cell-cell signaling	ISS
GO:0010595	Process	Positive regulation of endothelial cell migration	ISS
GO:0010698	Function	Acetyltransferase activator activity	IDA	17505058
GO:0016922	Function	Nuclear receptor binding	IPI	17505058
GO:0031252	Component	Cell leading edge	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	ISS
GO:0035035	Function	Histone acetyltransferase binding	IPI	17505058
GO:0035091	Function	Phosphatidylinositol binding	IDA	33499712
GO:0042393	Function	Histone binding	IDA	17505058
GO:0042594	Process	Response to starvation	IBA
GO:0043085	Process	Positive regulation of catalytic activity	IDA	17505058
GO:0043627	Process	Response to estrogen	IDA	16617102
GO:0045111	Component	Intermediate filament cytoskeleton	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17505058
GO:0048487	Function	Beta-tubulin binding	IDA	22300583
GO:0071391	Process	Cellular response to estrogen stimulus	IDA	17505058

MIM	HGNC	e!Ensembl
607470	14347	ENSG00000141376

Q9H6U6

Protein name

BCAS3 microtubule associated cell migration factor (Breast carcinoma-amplified sequence 3) (GAOB1)

Protein function

Plays a role in angiogenesis. Participates in the regulation of cell polarity and directional endothelial cell migration by mediating both the activation and recruitment of CDC42 and the reorganization of the actin cytoskeleton at the cell leadi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12490	BCAS3	521 → 797	Breast carcinoma amplified sequence 3	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in stomach, liver, lung, kidney, prostate, testis, thyroid gland, adrenal gland, brain, heart, skeletal muscle, colon, spleen, small intestine, placenta, blood leukocyte and mammary epithelial cells. Expressed in undifferenti

Sequence

MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKI
VWVRFENADLNDTSRNLEFHEIHSTGNEPPLLIMIGYSDGMQVWSIPISGEAQELFSVRH
GPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLYSLRTGEMVKS
IQFKTPIYDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCYPCPGPNMNPIALGSRWL
AYAENKLIRCHQSRGGACGDNIQSYTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTE
DDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFN
TSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLYTLHRGETEAKVQDICFSHDCRWV
VVSTLRGTSHVFPINPYGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCS
PVPGLSSSPSGSPLHGKLNSQDSYNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGT
ITKRTGPYLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKR
EKDQSKQVVVESLYIISCYGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTP
QWNELQPPFNANHPLLLAADAVQYYQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDE
EWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDF
DTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWP
EGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGS
IPRNFDGYRSPLPTNESQPLSLFPTGFP

Sequence length

928

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Global developmental delay	Likely pathogenic; Pathogenic	rs2144260660, rs761069193, rs2143782841, rs2144887794, rs2145000036, rs2145247321, rs2145432917, rs754857276, rs772813265, rs2143487816, rs2143538802	RCV001391657 RCV001391658 RCV001391646 RCV001391653 RCV001391647 View all (6 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hengel-Maroofian-Schols syndrome	Pathogenic; Likely pathogenic	rs769939544, rs2544663258, rs2143782841, rs2145000036, rs2145432917, rs754857276, rs772813265	RCV002251294 RCV003445299 RCV001788444 RCV001788445 RCV001788446 RCV001788447 RCV001788448 View all (2 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (32)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BCAS3-related disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER CALCULUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISEASE OF GENITOURINARY SYSTEM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOBAL DEVELOPMENTAL DELAY-INTELLECTUAL DISABILITY-MICROCEPHALY-SHORT STATURE-BRAIN IRON ACCUMULATION SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALUNION FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC NODULAR GOITER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETEROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	16320248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	25967671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Abscess	Brain Abscess	BEFREE	18030336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	18030336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	18030336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	18030336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	18030336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12378525, 16617102, 18030336, 22300583, 27506935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16617102, 18030336, 23260012, 27506935, 34240781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20383146, 29779033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GWASDB_DG	20383146, 22479191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	25514360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	26343387, 28714975, 29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASDB_DG	17804789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Medulloblastoma	Medulloblastoma	BEFREE	16400626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	31451708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	31451708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	Pubtator	32163230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18030336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	23263486		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	GWASCAT_DG	25967671		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	25967671, 29879923	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	29558500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	20383146, 31152163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21742584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12378525, 16617102, 18030336, 22300583, 27506935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22300583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16617102, 16855396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16617102, 16855396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16617102, 16855396, 18030336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	GWASCAT_DG	30975718		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

BCAS3 (BCAS3 microtubule associated cell migration factor)