TET2 (tet methylcytosine dioxygenase 2)

Gene

• Entrez ID: 54790
• Gene name: Tet methylcytosine dioxygenase 2
• Gene symbol: TET2
• Synonyms (NCBI Gene): IMD75, KIAA1546, MDS
• Chromosome: 4
• Chromosome location: 4q24
• Summary: The protein encoded by this gene is a methylcytosine dioxygenase that catalyzes the conversion of methylcytosine to 5-hydroxymethylcytosine. The encoded protein is involved in myelopoiesis, and defects in this gene have been associated with several myelop

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016981	hsa-miR-335-5p	Microarray	18185580
MIRT049648	hsa-miR-92a-3p	CLASH	23622248
MIRT042185	hsa-miR-484	CLASH	23622248
MIRT053224	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR	23830207
MIRT210981	hsa-miR-26a-5p	Luciferase reporter assay	24114270
MIRT438630	hsa-miR-125b-5p	Luciferase reporter assay	24120864
MIRT210969	hsa-miR-29b-3p	Luciferase reporter assay	24120864
MIRT210970	hsa-miR-29c-3p	Luciferase reporter assay	24120864
MIRT210927	hsa-miR-101-3p	Luciferase reporter assay	24120864
MIRT438629	hsa-miR-7-5p	Luciferase reporter assay	24120864
MIRT210968	hsa-miR-29a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23820384
MIRT210968	hsa-miR-29a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23820384
MIRT053224	hsa-miR-22-3p	Flow, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23827711
MIRT053224	hsa-miR-22-3p	Flow, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23827711
MIRT210981	hsa-miR-26a-5p	Luciferase reporter assay	24114270
MIRT438630	hsa-miR-125b-5p	Luciferase reporter assay	24120864
MIRT210969	hsa-miR-29b-3p	Luciferase reporter assay	24120864
MIRT210970	hsa-miR-29c-3p	Luciferase reporter assay	24120864
MIRT210927	hsa-miR-101-3p	Luciferase reporter assay	24120864
MIRT438629	hsa-miR-7-5p	Luciferase reporter assay	24120864
MIRT210968	hsa-miR-29a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23820384
MIRT210968	hsa-miR-29a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23820384
MIRT053224	hsa-miR-22-3p	Flow, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23827711
MIRT053224	hsa-miR-22-3p	Flow, Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23827711
MIRT390320	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT503332	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT503331	hsa-miR-3924	HITS-CLIP	21572407
MIRT503330	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT390320	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508338	hsa-miR-4775	HITS-CLIP	21572407
MIRT503332	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT503331	hsa-miR-3924	HITS-CLIP	21572407
MIRT503330	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT390320	hsa-miR-5011-5p	HITS-CLIP	22927820
MIRT508338	hsa-miR-4775	HITS-CLIP	22927820
MIRT503332	hsa-miR-190a-3p	HITS-CLIP	22927820
MIRT503331	hsa-miR-3924	HITS-CLIP	22927820
MIRT503330	hsa-miR-1277-5p	HITS-CLIP	22927820
MIRT508339	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT508338	hsa-miR-4775	PAR-CLIP	20371350
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT503331	hsa-miR-3924	PAR-CLIP	20371350
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508338	hsa-miR-4775	PAR-CLIP	21572407
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT503331	hsa-miR-3924	PAR-CLIP	21572407
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT503331	hsa-miR-3924	PAR-CLIP	21572407
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT508338	hsa-miR-4775	PAR-CLIP	22012620
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT508339	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508338	hsa-miR-4775	PAR-CLIP	23446348
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503331	hsa-miR-3924	PAR-CLIP	23446348
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508339	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508338	hsa-miR-4775	PAR-CLIP	23446348
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503331	hsa-miR-3924	PAR-CLIP	23446348
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503331	hsa-miR-3924	PAR-CLIP	23446348
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT210968	hsa-miR-29a-3p	Microarray, qRT-PCR	26251039
MIRT210968	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26404510
MIRT210969	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	26404510
MIRT390320	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT503332	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT503331	hsa-miR-3924	HITS-CLIP	21572407
MIRT503330	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT390320	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508338	hsa-miR-4775	HITS-CLIP	21572407
MIRT503332	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT503331	hsa-miR-3924	HITS-CLIP	21572407
MIRT503330	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT390320	hsa-miR-5011-5p	HITS-CLIP	22927820
MIRT508338	hsa-miR-4775	HITS-CLIP	22927820
MIRT503332	hsa-miR-190a-3p	HITS-CLIP	22927820
MIRT503331	hsa-miR-3924	HITS-CLIP	22927820
MIRT503330	hsa-miR-1277-5p	HITS-CLIP	22927820
MIRT508339	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT508338	hsa-miR-4775	PAR-CLIP	20371350
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT503331	hsa-miR-3924	PAR-CLIP	20371350
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508338	hsa-miR-4775	PAR-CLIP	21572407
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT503331	hsa-miR-3924	PAR-CLIP	21572407
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT503331	hsa-miR-3924	PAR-CLIP	21572407
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT508338	hsa-miR-4775	PAR-CLIP	22012620
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT508339	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508338	hsa-miR-4775	PAR-CLIP	23446348
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503331	hsa-miR-3924	PAR-CLIP	23446348
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508339	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508338	hsa-miR-4775	PAR-CLIP	23446348
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503331	hsa-miR-3924	PAR-CLIP	23446348
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT390320	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT503332	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT503331	hsa-miR-3924	PAR-CLIP	23446348
MIRT503330	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1418632	hsa-let-7a	CLIP-seq
MIRT1418633	hsa-let-7b	CLIP-seq
MIRT1418634	hsa-let-7c	CLIP-seq
MIRT1418635	hsa-let-7d	CLIP-seq
MIRT1418636	hsa-let-7e	CLIP-seq
MIRT1418637	hsa-let-7f	CLIP-seq
MIRT1418638	hsa-let-7g	CLIP-seq
MIRT1418639	hsa-let-7i	CLIP-seq
MIRT1418640	hsa-miR-101	CLIP-seq
MIRT1418641	hsa-miR-1208	CLIP-seq
MIRT1418642	hsa-miR-1257	CLIP-seq
MIRT1418643	hsa-miR-1264	CLIP-seq
MIRT1418644	hsa-miR-1273e	CLIP-seq
MIRT1418645	hsa-miR-1276	CLIP-seq
MIRT1418646	hsa-miR-1284	CLIP-seq
MIRT1418647	hsa-miR-1294	CLIP-seq
MIRT1418648	hsa-miR-1297	CLIP-seq
MIRT1418649	hsa-miR-1303	CLIP-seq
MIRT1418650	hsa-miR-1305	CLIP-seq
MIRT1418651	hsa-miR-132	CLIP-seq
MIRT1418652	hsa-miR-133a	CLIP-seq
MIRT1418653	hsa-miR-133b	CLIP-seq
MIRT1418654	hsa-miR-139-5p	CLIP-seq
MIRT1418655	hsa-miR-142-5p	CLIP-seq
MIRT1418656	hsa-miR-144	CLIP-seq
MIRT1418657	hsa-miR-148a	CLIP-seq
MIRT1418658	hsa-miR-148b	CLIP-seq
MIRT1418659	hsa-miR-152	CLIP-seq
MIRT1418660	hsa-miR-200b	CLIP-seq
MIRT1418661	hsa-miR-200c	CLIP-seq
MIRT1418662	hsa-miR-202	CLIP-seq
MIRT1418663	hsa-miR-203	CLIP-seq
MIRT1418664	hsa-miR-204	CLIP-seq
MIRT1418665	hsa-miR-2054	CLIP-seq
MIRT1418666	hsa-miR-210	CLIP-seq
MIRT1418667	hsa-miR-211	CLIP-seq
MIRT1418668	hsa-miR-2116	CLIP-seq
MIRT1418669	hsa-miR-212	CLIP-seq
MIRT1418670	hsa-miR-22	CLIP-seq
MIRT1418671	hsa-miR-23a	CLIP-seq
MIRT1418672	hsa-miR-23b	CLIP-seq
MIRT1418673	hsa-miR-23c	CLIP-seq
MIRT1418674	hsa-miR-26a	CLIP-seq
MIRT1418675	hsa-miR-26b	CLIP-seq
MIRT1418676	hsa-miR-29a	CLIP-seq
MIRT1418677	hsa-miR-29b	CLIP-seq
MIRT1418678	hsa-miR-29c	CLIP-seq
MIRT1418679	hsa-miR-300	CLIP-seq
MIRT1418680	hsa-miR-3065-3p	CLIP-seq
MIRT1418681	hsa-miR-3065-5p	CLIP-seq
MIRT1418682	hsa-miR-30a	CLIP-seq
MIRT1418683	hsa-miR-30b	CLIP-seq
MIRT1418684	hsa-miR-30c	CLIP-seq
MIRT1418685	hsa-miR-30d	CLIP-seq
MIRT1418686	hsa-miR-30e	CLIP-seq
MIRT1418687	hsa-miR-3121-3p	CLIP-seq
MIRT1418688	hsa-miR-3160-5p	CLIP-seq
MIRT1418689	hsa-miR-3163	CLIP-seq
MIRT1418690	hsa-miR-3187-3p	CLIP-seq
MIRT1418691	hsa-miR-326	CLIP-seq
MIRT1418692	hsa-miR-330-5p	CLIP-seq
MIRT1418693	hsa-miR-33a	CLIP-seq
MIRT1418694	hsa-miR-33b	CLIP-seq
MIRT1418695	hsa-miR-340	CLIP-seq
MIRT1418696	hsa-miR-3614-5p	CLIP-seq
MIRT1418697	hsa-miR-3646	CLIP-seq
MIRT1418698	hsa-miR-3647-3p	CLIP-seq
MIRT1418699	hsa-miR-3658	CLIP-seq
MIRT1418700	hsa-miR-3660	CLIP-seq
MIRT1418701	hsa-miR-3662	CLIP-seq
MIRT1418702	hsa-miR-3674	CLIP-seq
MIRT1418703	hsa-miR-3682-3p	CLIP-seq
MIRT1418704	hsa-miR-3685	CLIP-seq
MIRT1418705	hsa-miR-3689a-3p	CLIP-seq
MIRT1418706	hsa-miR-3689c	CLIP-seq
MIRT1418707	hsa-miR-3714	CLIP-seq
MIRT1418708	hsa-miR-371-5p	CLIP-seq
MIRT1418709	hsa-miR-380	CLIP-seq
MIRT1418710	hsa-miR-381	CLIP-seq
MIRT1418711	hsa-miR-384	CLIP-seq
MIRT1418712	hsa-miR-3910	CLIP-seq
MIRT1418713	hsa-miR-3929	CLIP-seq
MIRT1418714	hsa-miR-3977	CLIP-seq
MIRT1418715	hsa-miR-425	CLIP-seq
MIRT1418716	hsa-miR-4255	CLIP-seq
MIRT1418717	hsa-miR-4264	CLIP-seq
MIRT1418718	hsa-miR-4277	CLIP-seq
MIRT1418719	hsa-miR-429	CLIP-seq
MIRT1418720	hsa-miR-4291	CLIP-seq
MIRT1418721	hsa-miR-4300	CLIP-seq
MIRT1418722	hsa-miR-433	CLIP-seq
MIRT1418723	hsa-miR-4419b	CLIP-seq
MIRT1418724	hsa-miR-4421	CLIP-seq
MIRT1418725	hsa-miR-4422	CLIP-seq
MIRT1418726	hsa-miR-4435	CLIP-seq
MIRT1418727	hsa-miR-4446-5p	CLIP-seq
MIRT1418728	hsa-miR-4452	CLIP-seq
MIRT1418729	hsa-miR-4458	CLIP-seq
MIRT1418730	hsa-miR-4465	CLIP-seq
MIRT1418731	hsa-miR-4478	CLIP-seq
MIRT1418732	hsa-miR-4484	CLIP-seq
MIRT1418733	hsa-miR-4494	CLIP-seq
MIRT1418734	hsa-miR-4495	CLIP-seq
MIRT1418735	hsa-miR-4500	CLIP-seq
MIRT1418736	hsa-miR-4526	CLIP-seq
MIRT1418737	hsa-miR-4530	CLIP-seq
MIRT1418738	hsa-miR-4639-3p	CLIP-seq
MIRT1418739	hsa-miR-4666-3p	CLIP-seq
MIRT1418740	hsa-miR-4676-5p	CLIP-seq
MIRT1418741	hsa-miR-4677-3p	CLIP-seq
MIRT1418742	hsa-miR-4677-5p	CLIP-seq
MIRT1418743	hsa-miR-4679	CLIP-seq
MIRT1418744	hsa-miR-4690-5p	CLIP-seq
MIRT1418745	hsa-miR-4699-3p	CLIP-seq
MIRT1418746	hsa-miR-4701-5p	CLIP-seq
MIRT1418747	hsa-miR-4705	CLIP-seq
MIRT1418748	hsa-miR-4738-3p	CLIP-seq
MIRT1418749	hsa-miR-4755-5p	CLIP-seq
MIRT1418750	hsa-miR-4769-3p	CLIP-seq
MIRT1418751	hsa-miR-4771	CLIP-seq
MIRT1418752	hsa-miR-4797-3p	CLIP-seq
MIRT1418753	hsa-miR-494	CLIP-seq
MIRT1418754	hsa-miR-498	CLIP-seq
MIRT1418755	hsa-miR-499-3p	CLIP-seq
MIRT1418756	hsa-miR-499a-3p	CLIP-seq
MIRT1418757	hsa-miR-513a-3p	CLIP-seq
MIRT1418758	hsa-miR-520d-5p	CLIP-seq
MIRT1418759	hsa-miR-524-5p	CLIP-seq
MIRT1418760	hsa-miR-548an	CLIP-seq
MIRT1418761	hsa-miR-548m	CLIP-seq
MIRT1418762	hsa-miR-548s	CLIP-seq
MIRT1418763	hsa-miR-548u	CLIP-seq
MIRT1418764	hsa-miR-561	CLIP-seq
MIRT1418765	hsa-miR-575	CLIP-seq
MIRT1418766	hsa-miR-578	CLIP-seq
MIRT1418767	hsa-miR-588	CLIP-seq
MIRT1418768	hsa-miR-593	CLIP-seq
MIRT1418769	hsa-miR-623	CLIP-seq
MIRT1418770	hsa-miR-640	CLIP-seq
MIRT1418771	hsa-miR-668	CLIP-seq
MIRT1418772	hsa-miR-767-5p	CLIP-seq
MIRT1418773	hsa-miR-9	CLIP-seq
MIRT1418774	hsa-miR-920	CLIP-seq
MIRT1418775	hsa-miR-98	CLIP-seq
MIRT1418642	hsa-miR-1257	CLIP-seq
MIRT1418714	hsa-miR-3977	CLIP-seq
MIRT1418728	hsa-miR-4452	CLIP-seq
MIRT1418632	hsa-let-7a	CLIP-seq
MIRT1418633	hsa-let-7b	CLIP-seq
MIRT1418634	hsa-let-7c	CLIP-seq
MIRT1418635	hsa-let-7d	CLIP-seq
MIRT1418636	hsa-let-7e	CLIP-seq
MIRT1418637	hsa-let-7f	CLIP-seq
MIRT1418638	hsa-let-7g	CLIP-seq
MIRT1418639	hsa-let-7i	CLIP-seq
MIRT1418640	hsa-miR-101	CLIP-seq
MIRT2125552	hsa-miR-103a	CLIP-seq
MIRT2125553	hsa-miR-107	CLIP-seq
MIRT2125554	hsa-miR-1179	CLIP-seq
MIRT2125555	hsa-miR-1184	CLIP-seq
MIRT2125556	hsa-miR-1205	CLIP-seq
MIRT1418641	hsa-miR-1208	CLIP-seq
MIRT2125557	hsa-miR-1224-3p	CLIP-seq
MIRT2125558	hsa-miR-1236	CLIP-seq
MIRT2125559	hsa-miR-1248	CLIP-seq
MIRT1418642	hsa-miR-1257	CLIP-seq
MIRT1418648	hsa-miR-1297	CLIP-seq
MIRT2125560	hsa-miR-1301	CLIP-seq
MIRT1418650	hsa-miR-1305	CLIP-seq
MIRT2125561	hsa-miR-135a	CLIP-seq
MIRT2125562	hsa-miR-135b	CLIP-seq
MIRT1418654	hsa-miR-139-5p	CLIP-seq
MIRT2125563	hsa-miR-143	CLIP-seq
MIRT1418656	hsa-miR-144	CLIP-seq
MIRT2125564	hsa-miR-145	CLIP-seq
MIRT1418660	hsa-miR-200b	CLIP-seq
MIRT1418661	hsa-miR-200c	CLIP-seq
MIRT1418662	hsa-miR-202	CLIP-seq
MIRT1418664	hsa-miR-204	CLIP-seq
MIRT2125565	hsa-miR-2052	CLIP-seq
MIRT1418665	hsa-miR-2054	CLIP-seq
MIRT1418667	hsa-miR-211	CLIP-seq
MIRT2125566	hsa-miR-2113	CLIP-seq
MIRT2125567	hsa-miR-217	CLIP-seq
MIRT2125568	hsa-miR-2355-5p	CLIP-seq
MIRT1418671	hsa-miR-23a	CLIP-seq
MIRT1418672	hsa-miR-23b	CLIP-seq
MIRT1418673	hsa-miR-23c	CLIP-seq
MIRT1418674	hsa-miR-26a	CLIP-seq
MIRT1418675	hsa-miR-26b	CLIP-seq
MIRT1418676	hsa-miR-29a	CLIP-seq
MIRT1418677	hsa-miR-29b	CLIP-seq
MIRT1418678	hsa-miR-29c	CLIP-seq
MIRT2125569	hsa-miR-302a	CLIP-seq
MIRT2125570	hsa-miR-302b	CLIP-seq
MIRT2125571	hsa-miR-302c	CLIP-seq
MIRT2125572	hsa-miR-302d	CLIP-seq
MIRT2125573	hsa-miR-302e	CLIP-seq
MIRT1418680	hsa-miR-3065-3p	CLIP-seq
MIRT1418682	hsa-miR-30a	CLIP-seq
MIRT1418683	hsa-miR-30b	CLIP-seq
MIRT1418684	hsa-miR-30c	CLIP-seq
MIRT1418685	hsa-miR-30d	CLIP-seq
MIRT1418686	hsa-miR-30e	CLIP-seq
MIRT2125574	hsa-miR-3138	CLIP-seq
MIRT2125575	hsa-miR-3143	CLIP-seq
MIRT2125576	hsa-miR-3145-3p	CLIP-seq
MIRT2125577	hsa-miR-3158-5p	CLIP-seq
MIRT1418688	hsa-miR-3160-5p	CLIP-seq
MIRT2125578	hsa-miR-323-3p	CLIP-seq
MIRT2125579	hsa-miR-338-5p	CLIP-seq
MIRT1418693	hsa-miR-33a	CLIP-seq
MIRT1418694	hsa-miR-33b	CLIP-seq
MIRT1418695	hsa-miR-340	CLIP-seq
MIRT2125580	hsa-miR-3613-3p	CLIP-seq
MIRT1418698	hsa-miR-3647-3p	CLIP-seq
MIRT1418699	hsa-miR-3658	CLIP-seq
MIRT1418701	hsa-miR-3662	CLIP-seq
MIRT2125581	hsa-miR-3663-3p	CLIP-seq
MIRT2125582	hsa-miR-3671	CLIP-seq
MIRT1418702	hsa-miR-3674	CLIP-seq
MIRT1418704	hsa-miR-3685	CLIP-seq
MIRT2125583	hsa-miR-369-3p	CLIP-seq
MIRT2125584	hsa-miR-372	CLIP-seq
MIRT2125585	hsa-miR-373	CLIP-seq
MIRT2125586	hsa-miR-374a	CLIP-seq
MIRT2125587	hsa-miR-374b	CLIP-seq
MIRT1418709	hsa-miR-380	CLIP-seq
MIRT2125588	hsa-miR-382	CLIP-seq
MIRT1418713	hsa-miR-3929	CLIP-seq
MIRT2125589	hsa-miR-3938	CLIP-seq
MIRT1418714	hsa-miR-3977	CLIP-seq
MIRT1418716	hsa-miR-4255	CLIP-seq
MIRT1418717	hsa-miR-4264	CLIP-seq
MIRT2125590	hsa-miR-4276	CLIP-seq
MIRT1418718	hsa-miR-4277	CLIP-seq
MIRT2125591	hsa-miR-4286	CLIP-seq
MIRT1418719	hsa-miR-429	CLIP-seq
MIRT1418720	hsa-miR-4291	CLIP-seq
MIRT2125592	hsa-miR-4307	CLIP-seq
MIRT1418722	hsa-miR-433	CLIP-seq
MIRT2125593	hsa-miR-4330	CLIP-seq
MIRT1418723	hsa-miR-4419b	CLIP-seq
MIRT1418725	hsa-miR-4422	CLIP-seq
MIRT1418728	hsa-miR-4452	CLIP-seq
MIRT1418729	hsa-miR-4458	CLIP-seq
MIRT1418730	hsa-miR-4465	CLIP-seq
MIRT2125594	hsa-miR-4477a	CLIP-seq
MIRT1418731	hsa-miR-4478	CLIP-seq
MIRT1418734	hsa-miR-4495	CLIP-seq
MIRT1418735	hsa-miR-4500	CLIP-seq
MIRT1418738	hsa-miR-4639-3p	CLIP-seq
MIRT2125595	hsa-miR-4659a-3p	CLIP-seq
MIRT2125596	hsa-miR-4659b-3p	CLIP-seq
MIRT2125597	hsa-miR-4660	CLIP-seq
MIRT2125598	hsa-miR-4661-5p	CLIP-seq
MIRT2125599	hsa-miR-4668-3p	CLIP-seq
MIRT1418744	hsa-miR-4690-5p	CLIP-seq
MIRT2125600	hsa-miR-4712-5p	CLIP-seq
MIRT2125601	hsa-miR-4752	CLIP-seq
MIRT2125602	hsa-miR-4753-3p	CLIP-seq
MIRT1418749	hsa-miR-4755-5p	CLIP-seq
MIRT2125603	hsa-miR-4770	CLIP-seq
MIRT2125604	hsa-miR-4773	CLIP-seq
MIRT2125605	hsa-miR-4780	CLIP-seq
MIRT1418752	hsa-miR-4797-3p	CLIP-seq
MIRT2125606	hsa-miR-4800-5p	CLIP-seq
MIRT2125607	hsa-miR-490-3p	CLIP-seq
MIRT1418754	hsa-miR-498	CLIP-seq
MIRT1418755	hsa-miR-499-3p	CLIP-seq
MIRT1418756	hsa-miR-499a-3p	CLIP-seq
MIRT2125608	hsa-miR-5047	CLIP-seq
MIRT1418757	hsa-miR-513a-3p	CLIP-seq
MIRT2125609	hsa-miR-520a-3p	CLIP-seq
MIRT2125610	hsa-miR-520b	CLIP-seq
MIRT2125611	hsa-miR-520c-3p	CLIP-seq
MIRT2125612	hsa-miR-520d-3p	CLIP-seq
MIRT2125613	hsa-miR-520e	CLIP-seq
MIRT2125614	hsa-miR-543	CLIP-seq
MIRT2125615	hsa-miR-548aa	CLIP-seq
MIRT2125616	hsa-miR-548ac	CLIP-seq
MIRT2125617	hsa-miR-548ae	CLIP-seq
MIRT2125618	hsa-miR-548aj	CLIP-seq
MIRT2125619	hsa-miR-548am	CLIP-seq
MIRT1418760	hsa-miR-548an	CLIP-seq
MIRT2125620	hsa-miR-548d-3p	CLIP-seq
MIRT2125621	hsa-miR-548x	CLIP-seq
MIRT2125622	hsa-miR-548z	CLIP-seq
MIRT2125623	hsa-miR-556-3p	CLIP-seq
MIRT1418764	hsa-miR-561	CLIP-seq
MIRT2125624	hsa-miR-570	CLIP-seq
MIRT2125625	hsa-miR-582-5p	CLIP-seq
MIRT2125626	hsa-miR-600	CLIP-seq
MIRT2125627	hsa-miR-607	CLIP-seq
MIRT1418769	hsa-miR-623	CLIP-seq
MIRT2125628	hsa-miR-627	CLIP-seq
MIRT2125629	hsa-miR-633	CLIP-seq
MIRT1418770	hsa-miR-640	CLIP-seq
MIRT2125630	hsa-miR-649	CLIP-seq
MIRT2125631	hsa-miR-653	CLIP-seq
MIRT2125632	hsa-miR-656	CLIP-seq
MIRT1418772	hsa-miR-767-5p	CLIP-seq
MIRT2125633	hsa-miR-770-5p	CLIP-seq
MIRT2125634	hsa-miR-924	CLIP-seq
MIRT2125635	hsa-miR-942	CLIP-seq
MIRT2125636	hsa-miR-944	CLIP-seq
MIRT1418775	hsa-miR-98	CLIP-seq
MIRT1418632	hsa-let-7a	CLIP-seq
MIRT1418633	hsa-let-7b	CLIP-seq
MIRT1418634	hsa-let-7c	CLIP-seq
MIRT1418635	hsa-let-7d	CLIP-seq
MIRT1418636	hsa-let-7e	CLIP-seq
MIRT1418637	hsa-let-7f	CLIP-seq
MIRT1418638	hsa-let-7g	CLIP-seq
MIRT1418639	hsa-let-7i	CLIP-seq
MIRT1418640	hsa-miR-101	CLIP-seq
MIRT2125552	hsa-miR-103a	CLIP-seq
MIRT2125553	hsa-miR-107	CLIP-seq
MIRT2125555	hsa-miR-1184	CLIP-seq
MIRT2125556	hsa-miR-1205	CLIP-seq
MIRT1418641	hsa-miR-1208	CLIP-seq
MIRT2347906	hsa-miR-1255a	CLIP-seq
MIRT2347907	hsa-miR-1255b	CLIP-seq
MIRT1418642	hsa-miR-1257	CLIP-seq
MIRT2347908	hsa-miR-125a-3p	CLIP-seq
MIRT1418648	hsa-miR-1297	CLIP-seq
MIRT2125560	hsa-miR-1301	CLIP-seq
MIRT1418650	hsa-miR-1305	CLIP-seq
MIRT2347909	hsa-miR-1321	CLIP-seq
MIRT2125561	hsa-miR-135a	CLIP-seq
MIRT2125562	hsa-miR-135b	CLIP-seq
MIRT1418654	hsa-miR-139-5p	CLIP-seq
MIRT1418656	hsa-miR-144	CLIP-seq
MIRT2125564	hsa-miR-145	CLIP-seq
MIRT1418657	hsa-miR-148a	CLIP-seq
MIRT1418658	hsa-miR-148b	CLIP-seq
MIRT1418659	hsa-miR-152	CLIP-seq
MIRT2347910	hsa-miR-1827	CLIP-seq
MIRT1418660	hsa-miR-200b	CLIP-seq
MIRT1418661	hsa-miR-200c	CLIP-seq
MIRT1418662	hsa-miR-202	CLIP-seq
MIRT1418664	hsa-miR-204	CLIP-seq
MIRT1418665	hsa-miR-2054	CLIP-seq
MIRT1418666	hsa-miR-210	CLIP-seq
MIRT1418667	hsa-miR-211	CLIP-seq
MIRT1418674	hsa-miR-26a	CLIP-seq
MIRT1418675	hsa-miR-26b	CLIP-seq
MIRT1418676	hsa-miR-29a	CLIP-seq
MIRT1418677	hsa-miR-29b	CLIP-seq
MIRT1418678	hsa-miR-29c	CLIP-seq
MIRT1418680	hsa-miR-3065-3p	CLIP-seq
MIRT2125575	hsa-miR-3143	CLIP-seq
MIRT2125576	hsa-miR-3145-3p	CLIP-seq
MIRT2125577	hsa-miR-3158-5p	CLIP-seq
MIRT2347911	hsa-miR-3162-5p	CLIP-seq
MIRT2347912	hsa-miR-337-3p	CLIP-seq
MIRT1418695	hsa-miR-340	CLIP-seq
MIRT2347913	hsa-miR-3545-3p	CLIP-seq
MIRT2347914	hsa-miR-3591-5p	CLIP-seq
MIRT1418701	hsa-miR-3662	CLIP-seq
MIRT2125582	hsa-miR-3671	CLIP-seq
MIRT1418704	hsa-miR-3685	CLIP-seq
MIRT1418708	hsa-miR-371-5p	CLIP-seq
MIRT1418709	hsa-miR-380	CLIP-seq
MIRT1418711	hsa-miR-384	CLIP-seq
MIRT2347915	hsa-miR-3914	CLIP-seq
MIRT1418714	hsa-miR-3977	CLIP-seq
MIRT1418715	hsa-miR-425	CLIP-seq
MIRT1418716	hsa-miR-4255	CLIP-seq
MIRT1418717	hsa-miR-4264	CLIP-seq
MIRT2125590	hsa-miR-4276	CLIP-seq
MIRT1418718	hsa-miR-4277	CLIP-seq
MIRT1418719	hsa-miR-429	CLIP-seq
MIRT1418720	hsa-miR-4291	CLIP-seq
MIRT2125593	hsa-miR-4330	CLIP-seq
MIRT1418724	hsa-miR-4421	CLIP-seq
MIRT1418727	hsa-miR-4446-5p	CLIP-seq
MIRT1418728	hsa-miR-4452	CLIP-seq
MIRT1418729	hsa-miR-4458	CLIP-seq
MIRT1418730	hsa-miR-4465	CLIP-seq
MIRT2125594	hsa-miR-4477a	CLIP-seq
MIRT1418735	hsa-miR-4500	CLIP-seq
MIRT1418738	hsa-miR-4639-3p	CLIP-seq
MIRT2347916	hsa-miR-4642	CLIP-seq
MIRT2125597	hsa-miR-4660	CLIP-seq
MIRT2125598	hsa-miR-4661-5p	CLIP-seq
MIRT2347917	hsa-miR-4698	CLIP-seq
MIRT1418745	hsa-miR-4699-3p	CLIP-seq
MIRT2347918	hsa-miR-4700-3p	CLIP-seq
MIRT1418747	hsa-miR-4705	CLIP-seq
MIRT2125600	hsa-miR-4712-5p	CLIP-seq
MIRT2347919	hsa-miR-4714-3p	CLIP-seq
MIRT2347920	hsa-miR-4724-3p	CLIP-seq
MIRT2347921	hsa-miR-4731-3p	CLIP-seq
MIRT2347922	hsa-miR-4736	CLIP-seq
MIRT2347923	hsa-miR-4739	CLIP-seq
MIRT1418749	hsa-miR-4755-5p	CLIP-seq
MIRT2347924	hsa-miR-4756-5p	CLIP-seq
MIRT2125604	hsa-miR-4773	CLIP-seq
MIRT2347925	hsa-miR-4781-3p	CLIP-seq
MIRT1418752	hsa-miR-4797-3p	CLIP-seq
MIRT2347926	hsa-miR-4801	CLIP-seq
MIRT2125607	hsa-miR-490-3p	CLIP-seq
MIRT1418754	hsa-miR-498	CLIP-seq
MIRT1418755	hsa-miR-499-3p	CLIP-seq
MIRT1418756	hsa-miR-499a-3p	CLIP-seq
MIRT2125608	hsa-miR-5047	CLIP-seq
MIRT2347927	hsa-miR-5095	CLIP-seq
MIRT2125614	hsa-miR-543	CLIP-seq
MIRT2125616	hsa-miR-548ac	CLIP-seq
MIRT2125617	hsa-miR-548ae	CLIP-seq
MIRT2125618	hsa-miR-548aj	CLIP-seq
MIRT2125619	hsa-miR-548am	CLIP-seq
MIRT1418760	hsa-miR-548an	CLIP-seq
MIRT2125620	hsa-miR-548d-3p	CLIP-seq
MIRT2347928	hsa-miR-548p	CLIP-seq
MIRT1418763	hsa-miR-548u	CLIP-seq
MIRT2125621	hsa-miR-548x	CLIP-seq
MIRT2125622	hsa-miR-548z	CLIP-seq
MIRT2347929	hsa-miR-552	CLIP-seq
MIRT2347930	hsa-miR-556-5p	CLIP-seq
MIRT1418764	hsa-miR-561	CLIP-seq
MIRT2125625	hsa-miR-582-5p	CLIP-seq
MIRT2347931	hsa-miR-599	CLIP-seq
MIRT2125627	hsa-miR-607	CLIP-seq
MIRT1418769	hsa-miR-623	CLIP-seq
MIRT2125628	hsa-miR-627	CLIP-seq
MIRT2125630	hsa-miR-649	CLIP-seq
MIRT2125631	hsa-miR-653	CLIP-seq
MIRT2125632	hsa-miR-656	CLIP-seq
MIRT2347932	hsa-miR-657	CLIP-seq
MIRT1418771	hsa-miR-668	CLIP-seq
MIRT1418772	hsa-miR-767-5p	CLIP-seq
MIRT2125633	hsa-miR-770-5p	CLIP-seq
MIRT2347933	hsa-miR-873	CLIP-seq
MIRT2347934	hsa-miR-888	CLIP-seq
MIRT2125634	hsa-miR-924	CLIP-seq
MIRT2347935	hsa-miR-940	CLIP-seq
MIRT2125636	hsa-miR-944	CLIP-seq
MIRT1418775	hsa-miR-98	CLIP-seq
MIRT1418642	hsa-miR-1257	CLIP-seq
MIRT1418648	hsa-miR-1297	CLIP-seq
MIRT1418671	hsa-miR-23a	CLIP-seq
MIRT1418672	hsa-miR-23b	CLIP-seq
MIRT1418673	hsa-miR-23c	CLIP-seq
MIRT1418674	hsa-miR-26a	CLIP-seq
MIRT1418675	hsa-miR-26b	CLIP-seq
MIRT1418676	hsa-miR-29a	CLIP-seq
MIRT1418677	hsa-miR-29b	CLIP-seq
MIRT1418678	hsa-miR-29c	CLIP-seq
MIRT1418680	hsa-miR-3065-3p	CLIP-seq
MIRT1418707	hsa-miR-3714	CLIP-seq
MIRT1418714	hsa-miR-3977	CLIP-seq
MIRT1418720	hsa-miR-4291	CLIP-seq
MIRT1418728	hsa-miR-4452	CLIP-seq
MIRT1418730	hsa-miR-4465	CLIP-seq
MIRT1418733	hsa-miR-4494	CLIP-seq
MIRT1418750	hsa-miR-4769-3p	CLIP-seq
MIRT1418751	hsa-miR-4771	CLIP-seq
MIRT2395668	hsa-miR-4781-5p	CLIP-seq
MIRT1418760	hsa-miR-548an	CLIP-seq
MIRT2395669	hsa-miR-664	CLIP-seq
MIRT2347906	hsa-miR-1255a	CLIP-seq
MIRT2347907	hsa-miR-1255b	CLIP-seq
MIRT1418648	hsa-miR-1297	CLIP-seq
MIRT1418650	hsa-miR-1305	CLIP-seq
MIRT2125561	hsa-miR-135a	CLIP-seq
MIRT2125562	hsa-miR-135b	CLIP-seq
MIRT1418674	hsa-miR-26a	CLIP-seq
MIRT1418675	hsa-miR-26b	CLIP-seq
MIRT2125576	hsa-miR-3145-3p	CLIP-seq
MIRT2347912	hsa-miR-337-3p	CLIP-seq
MIRT2640726	hsa-miR-3653	CLIP-seq
MIRT1418699	hsa-miR-3658	CLIP-seq
MIRT2125582	hsa-miR-3671	CLIP-seq
MIRT1418730	hsa-miR-4465	CLIP-seq
MIRT2125594	hsa-miR-4477a	CLIP-seq
MIRT2347919	hsa-miR-4714-3p	CLIP-seq
MIRT2640727	hsa-miR-4766-3p	CLIP-seq
MIRT1418754	hsa-miR-498	CLIP-seq
MIRT2347928	hsa-miR-548p	CLIP-seq
MIRT2640728	hsa-miR-642b	CLIP-seq
MIRT2125632	hsa-miR-656	CLIP-seq
MIRT1418648	hsa-miR-1297	CLIP-seq
MIRT1418650	hsa-miR-1305	CLIP-seq
MIRT2125561	hsa-miR-135a	CLIP-seq
MIRT2125562	hsa-miR-135b	CLIP-seq
MIRT1418674	hsa-miR-26a	CLIP-seq
MIRT1418675	hsa-miR-26b	CLIP-seq
MIRT2125576	hsa-miR-3145-3p	CLIP-seq
MIRT2640726	hsa-miR-3653	CLIP-seq
MIRT1418699	hsa-miR-3658	CLIP-seq
MIRT2125582	hsa-miR-3671	CLIP-seq
MIRT1418730	hsa-miR-4465	CLIP-seq
MIRT2125594	hsa-miR-4477a	CLIP-seq
MIRT2347919	hsa-miR-4714-3p	CLIP-seq
MIRT1418754	hsa-miR-498	CLIP-seq
MIRT2640728	hsa-miR-642b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002521	Process	Leukocyte differentiation	IMP	32518946
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	23222540, 23353889, 25601757, 28514442, 29735542, 32814053, 33961781, 34667079
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006493	Process	Protein O-linked glycosylation	IDA	23222540
GO:0006493	Process	Protein O-linked glycosylation	IMP	23353889
GO:0008198	Function	Ferrous iron binding	IDA	24315485
GO:0008270	Function	Zinc ion binding	IDA	24315485
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016706	Function	2-oxoglutarate-dependent dioxygenase activity	IEA
GO:0030099	Process	Myeloid cell differentiation	IBA
GO:0030099	Process	Myeloid cell differentiation	IMP	21057493
GO:0040029	Process	Epigenetic regulation of gene expression	IEA
GO:0044029	Process	Positive regulation of gene expression via chromosomal CpG island demethylation	IDA	24315485
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	23222540, 23353889
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0070579	Function	DNA 5-methylcytosine dioxygenase activity	IBA
GO:0070579	Function	DNA 5-methylcytosine dioxygenase activity	IDA	24315485
GO:0070579	Function	DNA 5-methylcytosine dioxygenase activity	IEA
GO:0070579	Function	DNA 5-methylcytosine dioxygenase activity	IMP	21057493, 23222540, 32518946
GO:0070579	Function	DNA 5-methylcytosine dioxygenase activity	ISS

Other IDs

• MIM: 612839
• HGNC: 25941
• e!Ensembl: ENSG00000168769

Protein

• UniProt ID: Q6N021
• Protein name: Methylcytosine dioxygenase TET2 (EC 1.14.11.80)
• Protein function: Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) and plays a key role in active DNA demethylation. Has a preference for 5-hydroxymethylcytosine in CpG motifs. Also
• PDB: 4NM6, 5D9Y, 5DEU, 7NE3, 7NE6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12851	Tet_JBP	1290 → 1905	Oxygenase domain of the 2OGFeDO superfamily	Domain

• Tissue specificity: TISSUE SPECIFICITY: Broadly expressed. Highly expressed in hematopoietic cells; highest expression observed in granulocytes. Expression is reduced in granulocytes from peripheral blood of patients affected by myelodysplastic syndromes. {ECO:0000269|PubMed
• Sequence:

  MEQDRTNHVEGNRLSPFLIPSPPICQTEPLATKLQNGSPLPERAHPEVNGDTKWHSFKSY
  YGIPCMKGSQNSRVSPDFTQESRGYSKCLQNGGIKRTVSEPSLSGLLQIKKLKQDQKANG
  ERRNFGVSQERNPGESSQPNVSDLSDKKESVSSVAQENAVKDFTSFSTHNCSGPENPELQ
  ILNEQEGKSANYHDKNIVLLKNKAVLMPNGATVSASSVEHTHGELLEKTLSQYYPDCVSI
  AVQKTTSHINAINSQATNELSCEITHPSHTSGQINSAQTSNSELPPKPAAVVSEACDADD
  ADNASKLAAMLNTCSFQKPEQLQQQKSVFEICPSPAENNIQGTTKLASGEEFCSGSSSNL
  QAPGGSSERYLKQNEMNGAYFKQSSVFTKDSFSATTTPPPPSQLLLSPPPPLPQVPQLPS
  EGKSTLNGGVLEEHHHYPNQSNTTLLREVKIEGKPEAPPSQSPNPSTHVCSPSPMLSERP
  QNNCVNRNDIQTAGTMTVPLCSEKTRPMSEHLKHNPPIFGSSGELQDNCQQLMRNKEQEI
  LKGRDKEQTRDLVPPTQHYLKPGWIELKAPRFHQAESHLKRNEASLPSILQYQPNLSNQM
  TSKQYTGNSNMPGGLPRQAYTQKTTQLEHKSQMYQVEMNQGQSQGTVDQHLQFQKPSHQV
  HFSKTDHLPKAHVQSLCGTRFHFQQRADSQTEKLMSPVLKQHLNQQASETEPFSNSHLLQ
  HKPHKQAAQTQPSQSSHLPQNQQQQQKLQIKNKEEILQTFPHPQSNNDQQREGSFFGQTK
  VEECFHGENQYSKSSEFETHNVQMGLEEVQNINRRNSPYSQTMKSSACKIQVSCSNNTHL
  VSENKEQTTHPELFAGNKTQNLHHMQYFPNNVIPKQDLLHRCFQEQEQKSQQASVLQGYK
  NRNQDMSGQQAAQLAQQRYLIHNHANVFPVPDQGGSHTQTPPQKDTQKHAALRWHLLQKQ
  EQQQTQQPQTESCHSQMHRPIKVEPGCKPHACMHTAPPENKTWKKVTKQENPPASCDNVQ
  QKSIIETMEQHLKQFHAKSLFDHKALTLKSQKQVKVEMSGPVTVLTRQTTAAELDSHTPA
  LEQQTTSSEKTPTKRTAASVLNNFIESPSKLLDTPIKNLLDTPVKTQYDFPSCRCVEQII
  EKDEGPFYTHLGAGPNVAAIREIMEERFGQKGKAIRIERVIYTGKEGKSSQGCPIAKWVV
  RRSSSEEKLLCLVRERAGHTCEAAVIVILILVWEGIPLSLADKLYSELTETLRKYGTLTN
  RRCALNEERTCACQGLDPETCGASFSFGCSWSMYYNGCKFARSKIPRKFKLLGDDPKEEE
  KLESHLQNLSTLMAPTYKKLAPDAYNNQIEYEHRAPECRLGLKEGRPFSGVTACLDFCAH
  AHRDLHNMQNGSTLVCTLTREDNREFGGKPEDEQLHVLPLYKVSDVDEFGSVEAQEEKKR
  SGAIQVLSSFRRKVRMLAEPVKTCRQRKLEAKKAAAEKLSSLENSSNKNEKEKSAPSRTK
  QTENASQAKQLAELLRLSGPVMQQSQQPQPLQKQPPQPQQQQRPQQQQPHHPQTESVNSY
  SASGSTNPYMRRPNPVSPYPNSSHTSDIYGSTSPMNFYSTSSQAAGSYLNSSNPMNPYPG
  LLNQNTQYPSYQCNGNLSVDNCSPYLGSYSPQSQPMDLYRYPSQDPLSKLSLPPIHTLYQ
  PRFGNSQSFTSKYLGYGNQNMQGDGFSSCTIRPNVHHVGKLPPYPTHEMDGHFMGATSRL
  PPNLSNPNMDYKNGEHHSPSHIIHNYSAAPGMFNSSLHALHLQNKENDMLSHTANGLSKM
  LPALNHDRTACVQGGLHKLSDANGQEKQPLALVQGVASGAEDNDEVWSDSEQSFLDPDIG
  GVAVAPTHGSILIECAKRELHATTPLKNPNRNHPTRISLVFYQHKSMNEPKHGLALWEAK
  MAEKAREKEEECEKYGPDYVPQKSHGKKVKREPAEPHETSEPTYLRFIKSLAERTMSVTT
  DSTVTTSPYAFTRVTGPYNRYI

• Sequence length: 2002

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Angioimmunoblastic T-cell lymphoma	Pathogenic	rs1352258641, rs1245041497	RCV003447637 RCV003447657	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Clonal hematopoiesis	Pathogenic	rs2476537310	RCV003126394	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EBV-positive nodal T- and NK-cell lymphoma	Likely pathogenic; Pathogenic	rs772634266, rs575928986, rs1242089483, rs2476493944, rs2476750584, rs1730329392, rs1728692644, rs1729381211, rs2110232389, rs1322900367, rs2476498425, rs572712965, rs2476480900, rs2110315013, rs771408533, rs1728711651, rs2476494544	RCV004557990 RCV004557991 RCV004557992 RCV004557993 RCV004557994 RCV004557995 RCV004557996 RCV004557997 RCV004557999 RCV004558000 RCV004558001 RCV004558003 RCV004558004 RCV004558005 RCV004558006 RCV004558007 RCV004558008	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Immunodeficiency 75	Likely pathogenic	rs2476498043, rs1242089483	RCV003150599 RCV005036827	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple myeloma	Likely pathogenic	rs1578264146	RCV000984135	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Myelodysplastic syndrome	Pathogenic; Likely pathogenic	rs2110231198, rs1242089483	RCV002246770 RCV005036827	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
TET2-related disorder	Likely pathogenic	rs771168522	RCV003408319	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Third degree atrioventricular block	Pathogenic	rs2476533556	RCV002305645	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atypical chronic myeloid leukemia, BCR-ABL1 negative	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE ATRIOVENTRICULAR BLOCK	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF PHARYNX	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-INDUCED LYMPHOPROLIFERATIVE DISEASE DUE TO TET2 DEFICIENCY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL THROMBOCYTHEMIA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 75 WITH LYMPHOPROLIFERATION	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROMES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephroblastoma	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY ARTERIAL HYPERTENSION	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEZARY SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC MASTOCYTOSIS WITH ASSOCIATED HEMATOLOGIC NEOPLASM	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTHEMIA, ESSENTIAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONSILLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER RESPIRATORY TRACT DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	29729583		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	23099237, 27391574, 27881874, 29144447, 29274134, 29417354		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukaemia with myelodysplasia-related features	Myeloid Leukemia	Orphanet			★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia with multilineage dysplasia	Myeloid Leukemia With Multilineage Dysplasia	ORPHANET_DG	19557078		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	26285909		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	29735542		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	28823558		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	22430270, 31744691		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23831920, 30357811		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	26880370, 28881727		★☆☆☆☆ Found in Text Mining only
Aggressive systemic mastocytosis	Systemic Mastocytosis	Orphanet			★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	31778687		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	24077167		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	25512612		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	32243522	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	38225226	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	34587721, 37087521	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Macrocytic	Macrocytic anemia	Pubtator	35126364	Associate	★☆☆☆☆ Found in Text Mining only
Anemia of inadequate production	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anemia Refractory	Refractory anemia	Pubtator	26874914	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Macrocytic	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	39382597	Associate	★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	22215888, 22760778, 24345752, 24413734, 24413737, 25501021, 26719098, 27177312, 27353473, 27921272, 28157189, 28337768, 28543514, 28691928, 28889481, 30952970		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	CTD_human_DG	24413737		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30032927, 31561398		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30032927, 31561398		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	27819678		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	31504400, 32639511, 36680616	Associate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	28935248		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27821816, 28104796, 28636844, 28798687, 29195897, 29653065, 30439364, 30789660, 30890702, 31252000, 31766102		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34125889, 40305610	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	20334914, 27203213, 35299281, 36796016	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27821816, 28104796, 28636844, 28798687, 29195897, 29653065, 30439364, 30789660, 30890702, 31252000, 31766102		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	31990036, 33779075, 35385050, 36835370, 37197843	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35724849, 38598228	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26275994, 31640337		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	36314527	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	32518946	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30510015, 31120187		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	30457024		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	36864496	Associate	★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	27997762	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	34282735	Associate	★☆☆☆☆ Found in Text Mining only
Bjornstad syndrome	Bjornstad syndrome	Pubtator	37558665	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	21346257		★☆☆☆☆ Found in Text Mining only
Bohring syndrome	Bohring syndrome	Pubtator	22186017	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	30709865, 35427424	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	35185048	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Marrow failure syndromes	Bone marrow failure syndrome	BEFREE	30940907		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	35235761	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	37423059	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	23535729, 25751625, 29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	25362856, 26253945, 26354892, 28218902, 28785073		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	26207381, 26354892, 29316957, 30385776, 31704974, 33146288, 34689714, 35351824, 39261937	Associate	★☆☆☆☆ Found in Text Mining only
Budd-Chiari Syndrome	Budd-Chiari syndrome	BEFREE	22467227		★☆☆☆☆ Found in Text Mining only
Budd-Chiari Syndrome	Budd-Chiari syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25601757, 30385776, 37667220	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26880370, 30917865, 32390600, 34689714, 34905094, 35109986	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29944140		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35651922	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38470216	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	24292451	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34551979, 35173532	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28099906	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35109986	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25827305		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	35979940	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29728415, 30890702		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30890702, 32639511, 35339897, 35931086, 36441964, 39382597	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	34743536	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	HPO_DG			★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27644645, 31441600		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	21504050, 22430270, 26414667, 29664232, 31744691		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34905094	Associate	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	32066746	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24693539, 31845905		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	19262601, 19420352, 19564637, 19959098, 20008300, 20068184, 20186505, 20428194, 20629097, 20671051, 21057493, 21242185, 21904853, 22431577, 22467227, 22898539, 23066032, 23781511, 24740812, 26697989, 26843622, 28335073, 29991556, 31473630		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	28166215, 30804561		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	37399248	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26287468		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	28524162	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30390073, 31842975		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	30013992	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26816554, 30013992		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	30510241		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25557833, 25853800, 26816554, 28675510, 29641532, 30013992, 35660018, 37620362	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	30510241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	30510241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36806702	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	20629097, 21274003		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28052545, 29471939, 30566180		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	36097025, 39460851	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	34125889	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30867120		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30457024		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	27497531, 29866652, 31707836, 32442302, 32639511, 34050697, 34210413, 34413458, 34663818, 34793200, 34963005, 36097025, 36281508, 37934948, 39287426, 39382597, 39456832, 39849426	Associate	★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	31344030		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28911255, 30124451		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28847794, 29078029, 30032927, 30309805, 31561398		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	34282735	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	22186017	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27787562, 30022161, 30616756		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	27005421	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27787562, 30022161, 30616756		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	38305890	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26356709	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31836704		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26356709		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	30721151		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29705354		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	38172938	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23831920, 28731140, 30274972, 30357811		★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	31167116		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	26317209		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	26317209	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	28954882, 31133973		★☆☆☆☆ Found in Text Mining only
Dysplastic granulopoesis	Dysplastic granulopoesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	24832084		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28349832	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32658928	Associate	★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	BEFREE	22760778		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	31777116		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25827305		★☆☆☆☆ Found in Text Mining only
Erythroid hypoplasia	Erythroid hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26093090, 26873401, 27050164	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	25695618	Associate	★☆☆☆☆ Found in Text Mining only
Essential thrombocythemia	Thrombocythemia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Essential tremor	Pubtator	27447873	Associate	★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	28911255		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	30165126		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	25614448, 31311407, 32321919	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 1	Gaucher Disease	BEFREE	31221723		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	37909388	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28601635, 30888082		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30888082	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28601635, 30388142, 30888082		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21690245, 22399191, 28260066		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34905094, 38547058	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type VI	Glycogen Storage Disease	BEFREE	19564637		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29735542		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28052545, 29471939, 30566180		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30566180, 32639511, 33779075, 33832602, 35339897	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34210413	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	27389314, 27717004, 30709865, 31350794, 33786584	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	20061559, 21723201, 21920603, 22240200, 24220273, 25040794, 25977238, 26099018, 27644645, 27848178, 28440315, 28813659, 31563562, 31744691		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	20061559, 24693539, 30475948, 33512451, 34050697, 34120595, 34239136, 34570179, 36639817, 37774069	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	30371677	Inhibit	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	22240200, 31484061		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	23827711, 24120864, 24693539, 28813659, 29219176, 30371677, 31001476		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	25244093	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia b	Pubtator	35185048	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	38003211	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	34743536	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatic Vein Thrombosis	Hepatic Vein Thrombosis	BEFREE	22467227		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	28115406, 39261937	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10967573		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	36639817	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28636844		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	27174585	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	36806702	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25695618, 30566180		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypochromic anemia	Hypochromic anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	36485103	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25794157	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	39292770	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	37325673	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30109466		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31039157		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	39382597	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	26253945		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	19797729, 20008299, 21087791, 22328940, 22395470, 22511494, 22773603, 24164563, 25972343, 26771811, 29192651, 29227812		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	35173532	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20008300, 21508122, 21690245, 25040794, 25179374, 25362856, 25601757, 28823558, 29849141, 30526882, 31028744, 31467227, 31646775		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23996483, 24373966, 25326804, 25972343, 31707836, 35345350, 35973983, 36065607, 37467321, 37541212, 37591941	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25601757	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	20693430, 22186017, 22395470, 24693539, 25972343, 28973458, 35345350, 36065607, 37586297	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19420352, 20678218, 21130701, 21343549, 21504050, 21828143, 21881046, 22234698, 22343920, 22507776, 22535592, 22581002, 22912701, 22976956, 23349305, 23365461, 23996483, 24986689, 25022553, 25381129, 25412851, 25601757, 26110659, 26234722, 26375248, 26414667, 26568194, 27050425, 27391574, 27546487, 27992414, 27997762, 28039446, 28074068, 28407691, 28992762, 29274134, 29702001, 29795413, 29988143, 30282643, 30587503, 30745814, 31187595, 31638252, 31742675, 32066746, 32091281, 32209730, 32232485, 32619551, 32699322, 32938585, 32970934, 33255417, 33491606, 33711909, 33845873, 33860275, 33876209, 34064268, 34120595, 34258102, 34360855, 34663818, 35279121, 35345350, 35390143, 35973983, 36232714, 36271776, 36508705, 36580013, 36964937, 36991512, 37079859, 37459200, 37541212, 37586297, 37591941, 37774069, 37794021, 38019014, 39519198, 40133836	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36371552	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	37884893	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	19420352, 20693430, 21828135, 22017486, 22328940, 22395470, 23065512, 23319568, 24817963, 24970933, 25972343, 26648538, 26771811, 27164004, 28548124, 28555081, 29069007, 29160764, 29192651, 30635983, 30709865, 31048357, 32573691, 34500124, 35236051, 35443559, 38003211, 39337700	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	22511494	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	19372255, 20955399, 22912701, 35299281	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Neutrophilic Chronic	Neutrophilic leukemia	Pubtator	33822276, 36375042	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	29274134	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10653868, 19420352, 19564637, 20489055, 20678218, 21343549, 21494260, 21508122, 21828143, 21881046, 22017486, 22071137, 22116554, 22430270, 22431577, 22507776, 23099237, 23359070, 23507484, 23521373, 23645565, 23940084, 23996483, 24120864, 24164563, 24309525, 24524305, 24986689, 25200248, 25482556, 25601757, 25699704, 25886910, 26110659, 26118500, 26234722, 26414667, 26568194, 26666262, 26703470, 26984174, 27050425, 27391574, 27881874, 28039446, 28074068, 28167452, 28187034, 28400619, 28407691, 28823558, 28992762, 29029424, 29144447, 29219176, 29274134, 29331774, 29361987, 29664232, 29767839, 29988143, 30054307, 30396184, 30587503, 30741367, 30796038, 30994218, 31023266, 31187595, 31646775, 31682240, 31744691		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukemia, Myeloid, Chronic, Atypical, BCR-ABL Negative	Myeloid Leukemia	BEFREE	30635983		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	19420352, 19797729, 20693430, 21057493, 21087791, 22017486, 22328940, 22395470, 22511494, 22773603, 23319568, 24164563, 25510268, 25972343, 26771811, 27353473, 27707735, 28476038, 28826859, 29192651, 29227812, 29275866, 29666007, 30054307, 30635983, 31836856		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	26880370, 28881727		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29331390, 30070373, 31033072		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	35592687, 36314527	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	26509176		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	26509176	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28349832	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	37985171	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22760778, 27921272, 28003489, 30890702		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25326804, 25671252, 30890702, 32518946, 35533245, 37475138, 38429084	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	29666007		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10967573, 24598796		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	33512451, 37705050	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29735542		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	23535729		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25362856, 26253945, 26354892, 28218902, 28785073		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	24832084		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	23593118		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24832084, 26404510, 27486019, 27819678, 30917865		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30416662		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19420352, 19557078, 19797729, 20093295, 20195608, 21057493, 21087791, 21168469, 21343549, 21508122, 21723200, 21723201, 21794915, 21920603, 22017486, 22200996, 22234698, 22320381, 22760778, 23015417, 23389918, 23432690, 23760684, 24220273, 24693539, 25179374, 25362856, 25501021, 25510268, 25512612, 25853800, 26562302, 26703470, 26980223, 27036965, 27225590, 27819678, 27848178, 28188826, 28260066, 28394181, 28440315, 28521490, 28555413, 28826859, 29290626, 29331390, 29364877, 29467326, 29735542, 29876013, 29938218, 29944140, 30022161, 30390073, 30616756, 30726915, 30816036, 30917865, 31043609, 31310587, 31441600, 31484061, 31646775, 31713024		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30390073, 31842975		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	28675510		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	20428194, 23074272, 24389310, 24788138, 26562302		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	22905207, 24389310	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	19262599, 22905207, 23958953, 27214377	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	19262599, 20075725, 22905207, 23074272, 24465546, 24788138, 25688802, 27214377		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22980977, 27102770, 34843679, 39456832	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	23458759, 24980573, 28813659, 30538121, 31310587		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	GWASCAT_DG	24980573		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	GWASDB_DG	24980573		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	29641532	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28847794, 29078029, 30032927, 30309805, 31561398		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	30772903		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	28521175		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	19262599, 19797729		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	30583273		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	31171909		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	31171909	Associate	★☆☆☆☆ Found in Text Mining only
Multiple lineage myelodysplasia	Multiple lineage myelodysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12877670		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	24076602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24735979		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	24735979	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelodysplasia	Myelodysplasia	BEFREE	19557078, 21508122, 24218139, 24903747, 25512612, 29285580		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19372255, 19474426, 19483684, 19528370, 19557078, 19666869, 20171768, 20211165, 20428194, 20489055, 20573398, 20592488, 20678218, 20693430, 21057493, 21494260, 21508122, 21877899, 21881538, 21902648, 22017486, 22160087, 22712628, 22749034, 22875062, 23394086, 23432690, 23645565, 23660859, 23827711, 23996483, 24218139, 24218140, 24301955, 24903747, 25085016, 25200248, 25224413, 25510268, 25512612, 25697572, 25976472, 26277372, 26617797, 26984174, 27023522, 27389314, 27497531, 27694924, 27992414, 28167288, 28167661, 28187034, 28188970, 28476038, 28521175, 28823558, 28826859, 29227812, 29285580, 29795413, 30146412, 30152885, 30254129, 30454965, 30618061, 30770308, 30944118, 31101757, 31473630, 31484061, 31640337, 31744691		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	CTD_human_DG	19483684, 27992414		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	GENOMICS_ENGLAND_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	CGI_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	19388938, 20334914, 20678218, 20693430, 22017486, 22186017, 23319568, 23831921, 23996483, 24220272, 24962689, 25092778, 27389314, 27497531, 27717004, 27881874, 27992414, 28167661, 28255022, 29795413, 30254129, 30787430, 30861111, 31101757, 31208955, 31350794, 31804030, 31964915, 32299093, 32397113, 32476595, 32573691, 32781289, 32961553, 33172974, 33730109, 34125889, 34449560, 34587721, 34768283, 35013795, 35126364, 35279121, 35396491, 36436542, 36588411, 36737440, 37071125, 37288803, 37558665, 37586297, 37884893, 38305890, 40269371	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	26617797	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelodysplastic-Myeloproliferative Diseases	Myelodysplastic-Myeloproliferative Diseases	BEFREE	19372255, 28188970, 30618061		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	19262601, 19564637, 29285580, 30515541		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	ORPHANET_DG	19262601, 19557078		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	25972343		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21794915, 22489043, 28533480		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	19262599, 19262601, 19420352, 19474426, 19564637, 19797729, 20061559, 20489055, 20629097, 20671051, 21057493, 21173100, 21681191, 21904853, 22017486, 22200996, 22489043, 23009937, 23066032, 23781511, 25671252, 26843622, 30944118, 30994218, 31187595, 31473630		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	29795413	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Neoplasm, Unclassifiable	Myeloproliferative Neoplasm	BEFREE	23781511, 29417354		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19262599, 19528370, 20061559, 20195608, 21274003, 21324307, 22240200, 22391558, 23389918, 23393090, 24120864, 24220273, 24521710, 24693539, 24898826, 25200248, 25510268, 25886910, 26253945, 26379152, 26404510, 26686387, 26883102, 26984174, 27644645, 27819678, 28785073, 28794029, 28813659, 29398449, 29467326, 29515232, 30022161, 30222780, 30274972, 30385776, 30936070, 31187595, 31231651, 31266538, 31310587, 31570278, 31836856		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	21659357, 28400619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural Tube Defects	Neural tube defect	Pubtator	19372255, 24970933, 28255022, 33512451	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	38014648	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30323172	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30045709		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	34115096	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26356709		★☆☆☆☆ Found in Text Mining only
Non-compaction cardiomyopathy	Noncompaction cardiomyopathy	BEFREE	31541101		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30210621		★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	28671143		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	26253945		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	28735797, 30902528		★☆☆☆☆ Found in Text Mining only
Normocytic anemia	Anemia	BEFREE	28167288		★☆☆☆☆ Found in Text Mining only
Normocytic anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36806702	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	31430471	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31829736		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29515232, 30165126		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28115406	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28099906, 35238112	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	28642344		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28185758, 28247193, 28320196, 28735797, 28911255, 29042162, 29273705, 29380907, 29572948, 29891223, 30147869, 30564614, 30718220, 30737581, 30856121, 30862454, 31073716, 31167116, 31275543, 31291488, 31450510, 31725927, 31830986		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	29625875, 31060986		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	27986830, 31665686		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	35504600	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	22760778, 25501021, 27921272, 28157189		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	CTD_human_DG	24413734, 24413737		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	33144643	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	38244120	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	19262601, 19564637, 20671051, 21273266, 21904853, 22106054, 23066032, 25671252, 27447873, 29285580		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	ORPHANET_DG	19262601		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	19262601, 21273266, 23781511, 27447873, 28218607, 28370365, 32066200	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia vera	Polycythemia Vera	Orphanet			★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23015417, 31266538		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28911255, 30124451		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	19262601, 19564637, 21892083, 21904853, 23066032, 23781511, 26843622, 27447873, 29285580, 30515541		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	ORPHANET_DG	19262601, 19557078		★☆☆☆☆ Found in Text Mining only
Primary myelofibrosis	Myelofibrosis	Orphanet			★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	31665686		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24832084, 26404510, 27486019, 27819678, 30917865		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22219177, 23593118, 27486019, 29641532, 30917865	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	23593118		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	27819678		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33008340	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasiform eczema	Psoriasiform eczema	BEFREE	29542811		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29542811		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	28735797, 30902528		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	35581740	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	39849426	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26423011, 28655780	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	37045913	Associate	★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	ORPHANET_DG	19483684, 19557078		★☆☆☆☆ Found in Text Mining only
Refractory anemia	Anemia	Orphanet			★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	ORPHANET_DG	19483684, 19557078		★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	BEFREE	28188970, 30618061		★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	HPO_DG			★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	ORPHANET_DG	19483684, 19557078		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	30811101		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29728415		★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	31089247		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	23797736		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	34282735	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	19474426, 20428194, 21057493, 21508122		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	CTD_human_DG	26551667		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Shwachman syndrome	Shwachman Syndrome	BEFREE	15642668		★☆☆☆☆ Found in Text Mining only
Single lineage myelodysplasia	Single lineage myelodysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	34671345	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29542811		★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	BEFREE	31060986		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	22180010	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24122999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26093090		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30548484	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30416662		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	27829228	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27027260	Inhibit	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	34507355, 34743536	Associate	★☆☆☆☆ Found in Text Mining only
Systemic mastocytosis with associated clonal, hematologic non-mast-cell lineage disease	Systemic Mastocytosis With Associated Clonal, Hematologic Non-Mast-Cell Lineage Disease	ORPHANET_DG	25567135		★☆☆☆☆ Found in Text Mining only
Systemic mastocytosis with associated hematologic neoplasm	Systemic Mastocytosis With Associated Hematologic Neoplasm	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	23015417, 25501021, 27921272, 28157189, 28337768, 31371502		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	19262601, 23781511, 28218607, 32732354	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	ORPHANET_DG	19262601, 23781511		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocythemia, Essential	Thrombocythemia	BEFREE	19564637, 20671051, 22106054, 22706669, 25671252, 27447873		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytopenia	Thrombocytopenia	Pubtator	29069007, 33786584	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	Pubtator	32761230	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	35733370	Associate	★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	25482724, 28968686		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	25482724		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32390600	Associate	★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tyrosinemias	Tyrosinemia	Pubtator	34768283	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26192919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Undifferentiated carcinoma	Carcinoma	BEFREE	28084339		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26686387	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28798687, 31345433		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	39382597	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	33067622	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	28052545		★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	37909388	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	34847227, 37839675	Associate	★☆☆☆☆ Found in Text Mining only