BTG4 (BTG anti-proliferation factor 4)

Gene

• Entrez ID: 54766
• Gene name: BTG anti-proliferation factor 4
• Gene symbol: BTG4
• Synonyms (NCBI Gene): APRO3, OOMD8, OZEMA8, PC3B
• Chromosome: 11
• Chromosome location: 11q23.1
• Summary: The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT827251	hsa-miR-1298	CLIP-seq
MIRT827252	hsa-miR-299-3p	CLIP-seq
MIRT827253	hsa-miR-3620	CLIP-seq
MIRT827254	hsa-miR-4699-5p	CLIP-seq
MIRT827255	hsa-miR-4760-3p	CLIP-seq
MIRT827256	hsa-miR-576-3p	CLIP-seq
MIRT827257	hsa-miR-664	CLIP-seq
MIRT1944810	hsa-miR-3155	CLIP-seq
MIRT1944811	hsa-miR-3155b	CLIP-seq
MIRT1944812	hsa-miR-4659a-3p	CLIP-seq
MIRT1944813	hsa-miR-4659b-3p	CLIP-seq
MIRT827255	hsa-miR-4760-3p	CLIP-seq
MIRT1944814	hsa-miR-484	CLIP-seq
MIRT1944815	hsa-miR-764	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32502391
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	10995567
GO:0030182	Process	Neuron differentiation	TAS	10995567
GO:0051726	Process	Regulation of cell cycle	TAS	10995567

Other IDs

• MIM: 605673
• HGNC: 13862
• e!Ensembl: ENSG00000137707

Protein

• UniProt ID: Q9NY30
• Protein name: Protein BTG4 (BTG family member 4) (Protein PC3b)
• Protein function: Adapter protein that bridges CNOT7, a catalytic subunit of the CCR4-NOT complex, to EIF4E (By similarity). Facilitates maternal mRNAs decay during the maturation of oocytes and in the fertilized egg, and is required for the maternal-zygotic tran
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07742	BTG	1 → 115	BTG family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in oocytes after germinal vesicle breakdown (PubMed:32502391). Expressed in testis and in olfactory epithelium. {ECO:0000269|PubMed:32502391}.
• Sequence:

  MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCI
  RINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR
  WEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQVENLKQPFQS
  WLQIPRKKNVVDGRVGLLGNTYHGSQKHPKCYRPAMHRLDRIL

• Sequence length: 223

Pathways

KEGG:

RNA degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Oocyte maturation defect 8	Pathogenic; Likely pathogenic	rs1278468610, rs1865879702, rs1865886567, rs755402000, rs1865794708	RCV002465000 RCV001255197 RCV001255198 RCV001255199 RCV001255200	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
FEMALE INFERTILITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OOCYTE/ZYGOTE/EMBRYO MATURATION ARREST 8	—	Disgenet, HPO Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bone neoplasms	Bone neoplasms	BEFREE	12684122		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28922388		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28922388	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15672409, 21051931		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18519671, 21636702		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18519671		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21636702	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32093041	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33247598	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Female	Female infertility	Pubtator	34647228	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28922388		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19576178		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12684122, 18519671, 19576178		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19576178		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32093041	Inhibit	★☆☆☆☆ Found in Text Mining only