LY6K (lymphocyte antigen 6 family member K)

Gene

• Entrez ID: 54742
• Gene name: Lymphocyte antigen 6 family member K
• Gene symbol: LY6K
• Synonyms (NCBI Gene): CT97, HSJ001348, URLC10, ly-6K
• Chromosome: 8
• Chromosome location: 8q24.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001541	hsa-miR-155-5p	pSILAC	18668040
MIRT001541	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT031622	hsa-miR-16-5p	Proteomics	18668040
MIRT720692	hsa-miR-5683	HITS-CLIP	19536157
MIRT720691	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT720690	hsa-miR-329-5p	HITS-CLIP	19536157
MIRT720689	hsa-miR-1245b-3p	HITS-CLIP	19536157
MIRT720688	hsa-miR-6798-5p	HITS-CLIP	19536157
MIRT720687	hsa-miR-3127-5p	HITS-CLIP	19536157
MIRT720686	hsa-miR-30a-3p	HITS-CLIP	19536157
MIRT720685	hsa-miR-30d-3p	HITS-CLIP	19536157
MIRT720684	hsa-miR-30e-3p	HITS-CLIP	19536157
MIRT568775	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT568774	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT568772	hsa-miR-4494	PAR-CLIP	20371350
MIRT568773	hsa-miR-499b-5p	PAR-CLIP	20371350
MIRT568771	hsa-miR-412-3p	PAR-CLIP	20371350
MIRT568770	hsa-miR-6754-3p	PAR-CLIP	20371350
MIRT568769	hsa-miR-6837-3p	PAR-CLIP	20371350
MIRT568768	hsa-miR-6740-3p	PAR-CLIP	20371350
MIRT568767	hsa-miR-6802-3p	PAR-CLIP	20371350
MIRT568776	hsa-miR-6757-5p	PAR-CLIP	20371350
MIRT568775	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT568774	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT568772	hsa-miR-4494	PAR-CLIP	20371350
MIRT568773	hsa-miR-499b-5p	PAR-CLIP	20371350
MIRT568771	hsa-miR-412-3p	PAR-CLIP	20371350
MIRT568770	hsa-miR-6754-3p	PAR-CLIP	20371350
MIRT568769	hsa-miR-6837-3p	PAR-CLIP	20371350
MIRT568768	hsa-miR-6740-3p	PAR-CLIP	20371350
MIRT568767	hsa-miR-6802-3p	PAR-CLIP	20371350
MIRT512431	hsa-miR-5088-3p	PAR-CLIP	23446348
MIRT512430	hsa-miR-370-3p	PAR-CLIP	23446348
MIRT512429	hsa-miR-6893-3p	PAR-CLIP	23446348
MIRT512428	hsa-miR-1976	PAR-CLIP	23446348
MIRT512427	hsa-miR-4268	PAR-CLIP	23446348
MIRT512425	hsa-miR-4448	PAR-CLIP	23446348
MIRT512426	hsa-miR-515-5p	PAR-CLIP	23446348
MIRT512424	hsa-miR-519e-5p	PAR-CLIP	23446348
MIRT512423	hsa-miR-6772-3p	PAR-CLIP	23446348
MIRT720692	hsa-miR-5683	HITS-CLIP	19536157
MIRT720691	hsa-miR-6783-5p	HITS-CLIP	19536157
MIRT720690	hsa-miR-329-5p	HITS-CLIP	19536157
MIRT720689	hsa-miR-1245b-3p	HITS-CLIP	19536157
MIRT720688	hsa-miR-6798-5p	HITS-CLIP	19536157
MIRT720687	hsa-miR-3127-5p	HITS-CLIP	19536157
MIRT720686	hsa-miR-30a-3p	HITS-CLIP	19536157
MIRT720685	hsa-miR-30d-3p	HITS-CLIP	19536157
MIRT720684	hsa-miR-30e-3p	HITS-CLIP	19536157
MIRT568775	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT568774	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT568772	hsa-miR-4494	PAR-CLIP	20371350
MIRT568773	hsa-miR-499b-5p	PAR-CLIP	20371350
MIRT568771	hsa-miR-412-3p	PAR-CLIP	20371350
MIRT568770	hsa-miR-6754-3p	PAR-CLIP	20371350
MIRT568769	hsa-miR-6837-3p	PAR-CLIP	20371350
MIRT568768	hsa-miR-6740-3p	PAR-CLIP	20371350
MIRT568767	hsa-miR-6802-3p	PAR-CLIP	20371350
MIRT568776	hsa-miR-6757-5p	PAR-CLIP	20371350
MIRT568775	hsa-miR-382-3p	PAR-CLIP	20371350
MIRT568774	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT568772	hsa-miR-4494	PAR-CLIP	20371350
MIRT568773	hsa-miR-499b-5p	PAR-CLIP	20371350
MIRT568771	hsa-miR-412-3p	PAR-CLIP	20371350
MIRT568770	hsa-miR-6754-3p	PAR-CLIP	20371350
MIRT568769	hsa-miR-6837-3p	PAR-CLIP	20371350
MIRT568768	hsa-miR-6740-3p	PAR-CLIP	20371350
MIRT568767	hsa-miR-6802-3p	PAR-CLIP	20371350
MIRT512431	hsa-miR-5088-3p	PAR-CLIP	23446348
MIRT512430	hsa-miR-370-3p	PAR-CLIP	23446348
MIRT512429	hsa-miR-6893-3p	PAR-CLIP	23446348
MIRT512428	hsa-miR-1976	PAR-CLIP	23446348
MIRT512427	hsa-miR-4268	PAR-CLIP	23446348
MIRT512425	hsa-miR-4448	PAR-CLIP	23446348
MIRT512426	hsa-miR-515-5p	PAR-CLIP	23446348
MIRT512424	hsa-miR-519e-5p	PAR-CLIP	23446348
MIRT512423	hsa-miR-6772-3p	PAR-CLIP	23446348
MIRT1122894	hsa-miR-1224-5p	CLIP-seq
MIRT1122895	hsa-miR-3915	CLIP-seq
MIRT1122896	hsa-miR-3928	CLIP-seq
MIRT1122897	hsa-miR-3942-3p	CLIP-seq
MIRT1122898	hsa-miR-4490	CLIP-seq
MIRT1122899	hsa-miR-4496	CLIP-seq
MIRT1122900	hsa-miR-4689	CLIP-seq
MIRT1122901	hsa-miR-4774-5p	CLIP-seq
MIRT1122902	hsa-miR-653	CLIP-seq
MIRT1122903	hsa-miR-34b	CLIP-seq
MIRT1122904	hsa-miR-34c-3p	CLIP-seq
MIRT1122905	hsa-miR-3664-3p	CLIP-seq
MIRT1122906	hsa-miR-378	CLIP-seq
MIRT1122907	hsa-miR-378b	CLIP-seq
MIRT1122908	hsa-miR-378c	CLIP-seq
MIRT1122909	hsa-miR-378d	CLIP-seq
MIRT1122910	hsa-miR-378e	CLIP-seq
MIRT1122911	hsa-miR-378f	CLIP-seq
MIRT1122912	hsa-miR-378h	CLIP-seq
MIRT1122913	hsa-miR-378i	CLIP-seq
MIRT1122914	hsa-miR-422a	CLIP-seq
MIRT1122915	hsa-miR-4433	CLIP-seq
MIRT1122916	hsa-miR-4459	CLIP-seq
MIRT1122917	hsa-miR-4638-3p	CLIP-seq
MIRT1122918	hsa-miR-4683	CLIP-seq
MIRT1122919	hsa-miR-4768-3p	CLIP-seq
MIRT1122920	hsa-miR-510	CLIP-seq
MIRT1122921	hsa-miR-512-5p	CLIP-seq
MIRT2265234	hsa-miR-1827	CLIP-seq
MIRT2265235	hsa-miR-2467-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IBA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001669	Component	Acrosomal vesicle	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0007339	Process	Binding of sperm to zona pellucida	IBA
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 615093
• HGNC: 24225
• e!Ensembl: ENSG00000160886

Protein

• UniProt ID: Q17RY6
• Protein name: Lymphocyte antigen 6K (Ly-6K)
• Protein function: Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida (By similarity). May play a role in cell growth (PubMed:18089789).
• Tissue specificity: TISSUE SPECIFICITY: Specifically expressed in testis (at protein level). {ECO:0000269|PubMed:12516096, ECO:0000269|PubMed:18089789}.
• Sequence:

  MALLALLLVVALPRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRC
  KWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRY
  CNLEGPPINSSVFKEYAGSMGESCGGLWLAILLLLASIAAGLSLS

• Sequence length: 165

Pathways

Reactome:

Post-translational modification: synthesis of GPI-anchored proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BILIARY TRACT CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE GASTRIC ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT URINARY SYSTEM NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21063397		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17089039, 19639180, 27197181, 27304060, 27494879, 30655778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	22988241, 27304060	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26862846	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26862846, 30696738	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18089789		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21063397		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29568993		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	36768616	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31468517		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	GWASDB_DG	22387998		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17784873, 18089789		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17784873, 18089789		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32500232	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18452554	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32055849	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26862846	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17784873	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28926410		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17089039, 19639180, 27197181, 27304060, 27494879, 30655778		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17784873, 18089789		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29568993		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	18089789		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21063397		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17784873, 19639180, 22988241, 30655778		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17089039		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18089789, 27494879, 30249107, 30655778		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18089789, 30249107		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18089789		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22515502		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23481573	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12516096		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24398900	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	26862846	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21063397	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37076981	Stimulate	★☆☆☆☆ Found in Text Mining only