Gene Gene information from NCBI Gene database.
Entrez ID 54738
Gene name FEV transcription factor, ETS family member
Gene symbol FEV
Synonyms (NCBI Gene)
HSRNAFEVPET-1
Chromosome 2
Chromosome location 2q35
Summary This gene belongs to the ETS transcription factor family. ETS family members have a highly conserved 85-amino acid ETS domain that binds purine-rich DNA sequences. The alanine-rich C-terminus of this gene indicates that it may act as a transcription repre
miRNA miRNA information provided by mirtarbase database.
42
miRTarBase ID miRNA Experiments Reference
MIRT994887 hsa-miR-2467-5p CLIP-seq
MIRT994888 hsa-miR-3125 CLIP-seq
MIRT994889 hsa-miR-3609 CLIP-seq
MIRT994890 hsa-miR-3916 CLIP-seq
MIRT994891 hsa-miR-548ah CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607150 18562 ENSG00000163497
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99581
Protein name Protein FEV (Fifth Ewing variant protein) (PC12 ETS domain-containing transcription factor 1) (PC12 ETS factor 1) (Pet-1)
Protein function Functions as a transcriptional regulator. According to PubMed:12761502, it functions as a transcriptional repressor. Functions in the differentiation and the maintenance of the central serotonergic neurons. May play a role in cell growth. {ECO:0
PDB 2YPR , 3ZP5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00178 Ets 48 127 Ets-domain Domain
Tissue specificity TISSUE SPECIFICITY: In brain, exclusively expressed in the major serotonergic neurons of the dorsal and median raphe nuclei located in the midbrain and pons. Also detected in prostate and small intestine. {ECO:0000269|PubMed:15003288, ECO:0000269|PubMed:1
Sequence
MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADR
ANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGK
RYAYRFD
FQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNL
MAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH
Sequence length 238
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Transcriptional misregulation in cancer  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
6
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTISM SPECTRUM DISORDER CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Allergic rhinitis (disorder) Allergic rhinitis BEFREE 22186238
★☆☆☆☆
Found in Text Mining only
alpha 1-Antitrypsin Deficiency Alpha 1-Antitrypsin Deficiency BEFREE 15888825
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 10471619, 10873550, 10887316, 11029351, 11069822, 11344348, 11590369, 11790652, 12204870, 14735148, 14968124, 15509591, 15557128, 16178865, 16275386
View all (50 more)
★☆☆☆☆
Found in Text Mining only
Ataxia Telangiectasia Ataxia Telangiectasia BEFREE 21346370, 21449675, 22380734, 22524621
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorder Autism Pubtator 31209396 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 31209396
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders Autism Spectrum Disorder CTD_human_DG 31209396
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity Bronchial Hyperreactivity BEFREE 18823309, 19213780, 19236319, 20075051, 22017462
★☆☆☆☆
Found in Text Mining only
Bronchitis, Chronic Gastric Cancer BEFREE 11435248, 11751191, 20595226
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 38308202 Stimulate
★☆☆☆☆
Found in Text Mining only