FEV (FEV transcription factor, ETS family member)

Gene

• Entrez ID: 54738
• Gene name: FEV transcription factor, ETS family member
• Gene symbol: FEV
• Synonyms (NCBI Gene): HSRNAFEV, PET-1
• Chromosome: 2
• Chromosome location: 2q35
• Summary: This gene belongs to the ETS transcription factor family. ETS family members have a highly conserved 85-amino acid ETS domain that binds purine-rich DNA sequences. The alanine-rich C-terminus of this gene indicates that it may act as a transcription repre

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT994888	hsa-miR-3125	CLIP-seq
MIRT994889	hsa-miR-3609	CLIP-seq
MIRT994890	hsa-miR-3916	CLIP-seq
MIRT994891	hsa-miR-548ah	CLIP-seq
MIRT994892	hsa-miR-548t	CLIP-seq
MIRT994893	hsa-miR-563	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994895	hsa-miR-877	CLIP-seq
MIRT2229088	hsa-miR-4476	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2532759	hsa-miR-4290	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2532760	hsa-miR-4532	CLIP-seq
MIRT2532761	hsa-miR-4707-5p	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq
MIRT994887	hsa-miR-2467-5p	CLIP-seq
MIRT2449624	hsa-miR-3649	CLIP-seq
MIRT2449625	hsa-miR-3661	CLIP-seq
MIRT2449626	hsa-miR-4254	CLIP-seq
MIRT2532759	hsa-miR-4290	CLIP-seq
MIRT2449627	hsa-miR-4497	CLIP-seq
MIRT2532760	hsa-miR-4532	CLIP-seq
MIRT2532761	hsa-miR-4707-5p	CLIP-seq
MIRT2449628	hsa-miR-492	CLIP-seq
MIRT2449629	hsa-miR-619	CLIP-seq
MIRT2449630	hsa-miR-631	CLIP-seq
MIRT994894	hsa-miR-769-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0042551	Process	Neuron maturation	IEA
GO:0042711	Process	Maternal behavior	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048665	Process	Neuron fate specification	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 607150
• HGNC: 18562
• e!Ensembl: ENSG00000163497

Protein

• UniProt ID: Q99581
• Protein name: Protein FEV (Fifth Ewing variant protein) (PC12 ETS domain-containing transcription factor 1) (PC12 ETS factor 1) (Pet-1)
• Protein function: Functions as a transcriptional regulator. According to PubMed:12761502, it functions as a transcriptional repressor. Functions in the differentiation and the maintenance of the central serotonergic neurons. May play a role in cell growth. {ECO:0
• PDB: 2YPR, 3ZP5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00178	Ets	48 → 127	Ets-domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: In brain, exclusively expressed in the major serotonergic neurons of the dorsal and median raphe nuclei located in the midbrain and pons. Also detected in prostate and small intestine. {ECO:0000269|PubMed:15003288, ECO:0000269|PubMed:1
• Sequence:

  MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADR
  ANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGK
  RYAYRFDFQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNL
  MAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH

• Sequence length: 238

Pathways

KEGG:

Transcriptional misregulation in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	22186238		★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	15888825		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10471619, 10873550, 10887316, 11029351, 11069822, 11344348, 11590369, 11790652, 12204870, 14735148, 14968124, 15509591, 15557128, 16178865, 16275386, 16293801, 16387804, 16409202, 16950282, 17099076, 17208586, 17302903, 17336509, 17459892, 17508966, 17900681, 18535015, 18823309, 19064281, 19191136, 19236319, 19430548, 19536153, 19748656, 19796199, 19895365, 19925425, 19996333, 20018959, 20159242, 20175803, 20338742, 20546196, 20597903, 20708396, 20864153, 21086123, 21211650, 21385196, 21436250, 21449675, 21468164, 21511453, 21804548, 22088612, 22377711, 22380734, 22468095, 22498476, 22519966, 22524621, 22538805, 22792082, 23548524, 31172686		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	21346370, 21449675, 22380734, 22524621		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31209396	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31209396		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	CTD_human_DG	31209396		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	18823309, 19213780, 19236319, 20075051, 22017462		★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	11435248, 11751191, 20595226		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38308202	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21304900, 21411501		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19926868		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	10712324, 10802223, 11148177, 11704589, 11848724, 12719384, 15175276, 15454649, 15994259, 16456143, 17090574, 17436040, 17690329, 18258629, 19131638, 19208460, 19213780, 19279160, 19359268, 19513904, 19726494, 19747908, 19796199, 19797132, 19878584, 20018959, 20299531, 20448057, 20562129, 20595226, 20732852, 21163806, 21304900, 21423603, 21430361, 21653927, 21943069, 22080838, 22161163, 22914670, 22952638, 25182044, 25299874, 28082375, 29339421		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	10767244, 12111878, 15745932, 16690975, 17469153, 19431193, 19843100, 20448091, 20457545, 21703359, 22035343, 22860029, 23164641, 23276841, 28409283, 28664245		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	24100022		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	18073125		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22112935		★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Diffuse Panbronchiolitis	BEFREE	15147354		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	18073125		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	11295668, 11435248, 16487239, 20338742		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29130979, 30717809		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29130979, 30717809		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	17620387, 24898918, 30257034, 31756779, 31831298, 9121764		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11120905, 11180668, 16858011, 20457545, 21468164, 22035343		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	10607488, 10631210		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	21468164		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29130979, 30717809		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21304900, 21411501		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23632960		★☆☆☆☆ Found in Text Mining only
Meconium ileus	Meconium ileus	BEFREE	15003957, 28409283		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	24100022		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	20480378		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	20480378		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	10574242, 10976720, 30887722, 31831298		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	16741151, 20856828		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31831298		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35548776	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	17035444, 18565956, 19131638, 22732410		★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	19878195		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	21468164		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	11796434		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	17334332		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	15744536		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	17620387		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	12186432, 17334332, 17620387, 31756779, 32362012	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28821979		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15515496		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	28545563		★☆☆☆☆ Found in Text Mining only