TMEM106B (transmembrane protein 106B)

Gene

• Entrez ID: 54664
• Gene name: Transmembrane protein 106B
• Gene symbol: TMEM106B
• Synonyms (NCBI Gene): HLD16
• Chromosome: 7
• Chromosome location: 7p21.3

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1554310600	G>A	Likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019872	hsa-miR-375	Microarray	20215506
MIRT047527	hsa-miR-10a-5p	CLASH	23622248
MIRT046151	hsa-miR-30b-5p	CLASH	23622248
MIRT037240	hsa-miR-877-5p	CLASH	23622248
MIRT553571	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT520675	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT520681	hsa-miR-567	HITS-CLIP	21572407
MIRT520680	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT520679	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT520678	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT520677	hsa-miR-3924	HITS-CLIP	21572407
MIRT520676	hsa-miR-297	HITS-CLIP	21572407
MIRT679831	hsa-miR-4438	HITS-CLIP	23824327
MIRT679830	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT679829	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT679828	hsa-miR-4258	HITS-CLIP	23824327
MIRT679827	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT679826	hsa-miR-4532	HITS-CLIP	23824327
MIRT679825	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT679824	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT679823	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT679822	hsa-miR-1292-3p	HITS-CLIP	23824327
MIRT679821	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT679820	hsa-miR-1976	HITS-CLIP	23824327
MIRT679819	hsa-miR-4707-3p	HITS-CLIP	23824327
MIRT679818	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT679817	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT679816	hsa-miR-3199	HITS-CLIP	23824327
MIRT679815	hsa-miR-8052	HITS-CLIP	23824327
MIRT679814	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT679813	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT679812	hsa-miR-5095	HITS-CLIP	23824327
MIRT679811	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT679810	hsa-miR-4279	HITS-CLIP	23824327
MIRT508754	hsa-miR-8084	PAR-CLIP	20371350
MIRT508753	hsa-miR-1255a	PAR-CLIP	20371350
MIRT508752	hsa-miR-1255b-5p	PAR-CLIP	20371350
MIRT508751	hsa-miR-1206	PAR-CLIP	20371350
MIRT508750	hsa-miR-6516-3p	PAR-CLIP	20371350
MIRT498934	hsa-miR-4302	PAR-CLIP	20371350
MIRT498933	hsa-miR-4289	PAR-CLIP	20371350
MIRT498932	hsa-miR-145-3p	PAR-CLIP	20371350
MIRT498931	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT498930	hsa-miR-6077	PAR-CLIP	20371350
MIRT498929	hsa-miR-3190-3p	PAR-CLIP	20371350
MIRT498928	hsa-miR-6833-5p	PAR-CLIP	20371350
MIRT498927	hsa-miR-4752	PAR-CLIP	20371350
MIRT498926	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT498934	hsa-miR-4302	PAR-CLIP	20371350
MIRT498933	hsa-miR-4289	PAR-CLIP	20371350
MIRT498932	hsa-miR-145-3p	PAR-CLIP	20371350
MIRT498931	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT498930	hsa-miR-6077	PAR-CLIP	20371350
MIRT498929	hsa-miR-3190-3p	PAR-CLIP	20371350
MIRT498928	hsa-miR-6833-5p	PAR-CLIP	20371350
MIRT498927	hsa-miR-4752	PAR-CLIP	20371350
MIRT498926	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT553571	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT520681	hsa-miR-567	PAR-CLIP	21572407
MIRT520680	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT520679	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT520678	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520677	hsa-miR-3924	PAR-CLIP	21572407
MIRT520676	hsa-miR-297	PAR-CLIP	21572407
MIRT520675	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT508754	hsa-miR-8084	PAR-CLIP	21572407
MIRT508753	hsa-miR-1255a	PAR-CLIP	21572407
MIRT508752	hsa-miR-1255b-5p	PAR-CLIP	21572407
MIRT508751	hsa-miR-1206	PAR-CLIP	21572407
MIRT508750	hsa-miR-6516-3p	PAR-CLIP	21572407
MIRT498934	hsa-miR-4302	PAR-CLIP	21572407
MIRT498933	hsa-miR-4289	PAR-CLIP	21572407
MIRT498932	hsa-miR-145-3p	PAR-CLIP	21572407
MIRT498931	hsa-miR-7-5p	PAR-CLIP	21572407
MIRT498930	hsa-miR-6077	PAR-CLIP	21572407
MIRT498929	hsa-miR-3190-3p	PAR-CLIP	21572407
MIRT498928	hsa-miR-6833-5p	PAR-CLIP	21572407
MIRT498927	hsa-miR-4752	PAR-CLIP	21572407
MIRT498926	hsa-miR-670-3p	PAR-CLIP	21572407
MIRT508754	hsa-miR-8084	PAR-CLIP	21572407
MIRT508753	hsa-miR-1255a	PAR-CLIP	21572407
MIRT508752	hsa-miR-1255b-5p	PAR-CLIP	21572407
MIRT508751	hsa-miR-1206	PAR-CLIP	21572407
MIRT508750	hsa-miR-6516-3p	PAR-CLIP	21572407
MIRT508749	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT498934	hsa-miR-4302	PAR-CLIP	21572407
MIRT498933	hsa-miR-4289	PAR-CLIP	21572407
MIRT498932	hsa-miR-145-3p	PAR-CLIP	21572407
MIRT498931	hsa-miR-7-5p	PAR-CLIP	21572407
MIRT498930	hsa-miR-6077	PAR-CLIP	21572407
MIRT498929	hsa-miR-3190-3p	PAR-CLIP	21572407
MIRT498928	hsa-miR-6833-5p	PAR-CLIP	21572407
MIRT498927	hsa-miR-4752	PAR-CLIP	21572407
MIRT498926	hsa-miR-670-3p	PAR-CLIP	21572407
MIRT520681	hsa-miR-567	PAR-CLIP	23446348
MIRT520680	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT520679	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT520678	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT520677	hsa-miR-3924	PAR-CLIP	23446348
MIRT520676	hsa-miR-297	PAR-CLIP	23446348
MIRT520675	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT508754	hsa-miR-8084	PAR-CLIP	23446348
MIRT508753	hsa-miR-1255a	PAR-CLIP	23446348
MIRT508752	hsa-miR-1255b-5p	PAR-CLIP	23446348
MIRT508751	hsa-miR-1206	PAR-CLIP	23446348
MIRT508750	hsa-miR-6516-3p	PAR-CLIP	23446348
MIRT498934	hsa-miR-4302	PAR-CLIP	23446348
MIRT498933	hsa-miR-4289	PAR-CLIP	23446348
MIRT498932	hsa-miR-145-3p	PAR-CLIP	23446348
MIRT498931	hsa-miR-7-5p	PAR-CLIP	23446348
MIRT498930	hsa-miR-6077	PAR-CLIP	23446348
MIRT498929	hsa-miR-3190-3p	PAR-CLIP	23446348
MIRT498928	hsa-miR-6833-5p	PAR-CLIP	23446348
MIRT498927	hsa-miR-4752	PAR-CLIP	23446348
MIRT498926	hsa-miR-670-3p	PAR-CLIP	23446348
MIRT508754	hsa-miR-8084	PAR-CLIP	23446348
MIRT508753	hsa-miR-1255a	PAR-CLIP	23446348
MIRT508752	hsa-miR-1255b-5p	PAR-CLIP	23446348
MIRT508751	hsa-miR-1206	PAR-CLIP	23446348
MIRT508750	hsa-miR-6516-3p	PAR-CLIP	23446348
MIRT508749	hsa-miR-7156-3p	PAR-CLIP	23446348
MIRT498934	hsa-miR-4302	PAR-CLIP	24398324
MIRT498933	hsa-miR-4289	PAR-CLIP	24398324
MIRT498932	hsa-miR-145-3p	PAR-CLIP	24398324
MIRT498931	hsa-miR-7-5p	PAR-CLIP	24398324
MIRT498930	hsa-miR-6077	PAR-CLIP	24398324
MIRT498929	hsa-miR-3190-3p	PAR-CLIP	24398324
MIRT498928	hsa-miR-6833-5p	PAR-CLIP	24398324
MIRT498927	hsa-miR-4752	PAR-CLIP	24398324
MIRT498926	hsa-miR-670-3p	PAR-CLIP	24398324
MIRT449420	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT445005	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT449418	hsa-miR-3714	PAR-CLIP	22100165
MIRT449419	hsa-miR-1910-3p	PAR-CLIP	22100165
MIRT449417	hsa-miR-6511a-5p	PAR-CLIP	22100165
MIRT445004	hsa-miR-4738-3p	PAR-CLIP	22100165
MIRT445003	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT239476	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445012	hsa-miR-148a-5p	PAR-CLIP	22100165
MIRT445010	hsa-miR-5584-3p	PAR-CLIP	22100165
MIRT445011	hsa-miR-4635	PAR-CLIP	22100165
MIRT239477	hsa-miR-1252-5p	PAR-CLIP	22100165
MIRT445009	hsa-miR-6124	PAR-CLIP	22100165
MIRT445008	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445007	hsa-miR-6126	PAR-CLIP	22100165
MIRT445006	hsa-miR-6864-5p	PAR-CLIP	22100165
MIRT445005	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445004	hsa-miR-4738-3p	PAR-CLIP	22100165
MIRT445003	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT439444	hsa-miR-376c-3p	HITS-CLIP	24374217
MIRT220279	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT220280	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT439444	hsa-miR-376c-3p	HITS-CLIP	24374217
MIRT520678	hsa-miR-190a-3p	HITS-CLIP	27418678
MIRT520678	hsa-miR-190a-3p	HITS-CLIP	27418678
MIRT520680	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT520680	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT520676	hsa-miR-297	HITS-CLIP	27418678
MIRT520676	hsa-miR-297	HITS-CLIP	27418678
MIRT520677	hsa-miR-3924	HITS-CLIP	27418678
MIRT520677	hsa-miR-3924	HITS-CLIP	27418678
MIRT553571	hsa-miR-5011-5p	HITS-CLIP	27418678
MIRT520681	hsa-miR-567	HITS-CLIP	27418678
MIRT520681	hsa-miR-567	HITS-CLIP	27418678
MIRT520675	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT520675	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT520679	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT520679	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT553571	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT520675	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT520681	hsa-miR-567	HITS-CLIP	21572407
MIRT520680	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT520679	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT520678	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT520677	hsa-miR-3924	HITS-CLIP	21572407
MIRT520676	hsa-miR-297	HITS-CLIP	21572407
MIRT679831	hsa-miR-4438	HITS-CLIP	23824327
MIRT679830	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT679829	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT679828	hsa-miR-4258	HITS-CLIP	23824327
MIRT679827	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT679826	hsa-miR-4532	HITS-CLIP	23824327
MIRT679825	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT679824	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT679823	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT679822	hsa-miR-1292-3p	HITS-CLIP	23824327
MIRT679821	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT679820	hsa-miR-1976	HITS-CLIP	23824327
MIRT679819	hsa-miR-4707-3p	HITS-CLIP	23824327
MIRT679818	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT679817	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT679816	hsa-miR-3199	HITS-CLIP	23824327
MIRT679815	hsa-miR-8052	HITS-CLIP	23824327
MIRT679814	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT679813	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT679812	hsa-miR-5095	HITS-CLIP	23824327
MIRT679811	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT679810	hsa-miR-4279	HITS-CLIP	23824327
MIRT508754	hsa-miR-8084	PAR-CLIP	20371350
MIRT508753	hsa-miR-1255a	PAR-CLIP	20371350
MIRT508752	hsa-miR-1255b-5p	PAR-CLIP	20371350
MIRT508751	hsa-miR-1206	PAR-CLIP	20371350
MIRT508750	hsa-miR-6516-3p	PAR-CLIP	20371350
MIRT498934	hsa-miR-4302	PAR-CLIP	20371350
MIRT498933	hsa-miR-4289	PAR-CLIP	20371350
MIRT498932	hsa-miR-145-3p	PAR-CLIP	20371350
MIRT498931	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT498930	hsa-miR-6077	PAR-CLIP	20371350
MIRT498929	hsa-miR-3190-3p	PAR-CLIP	20371350
MIRT498928	hsa-miR-6833-5p	PAR-CLIP	20371350
MIRT498927	hsa-miR-4752	PAR-CLIP	20371350
MIRT498926	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT498934	hsa-miR-4302	PAR-CLIP	20371350
MIRT498933	hsa-miR-4289	PAR-CLIP	20371350
MIRT498932	hsa-miR-145-3p	PAR-CLIP	20371350
MIRT498931	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT498930	hsa-miR-6077	PAR-CLIP	20371350
MIRT498929	hsa-miR-3190-3p	PAR-CLIP	20371350
MIRT498928	hsa-miR-6833-5p	PAR-CLIP	20371350
MIRT498927	hsa-miR-4752	PAR-CLIP	20371350
MIRT498926	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT553571	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT520681	hsa-miR-567	PAR-CLIP	21572407
MIRT520680	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT520679	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT520678	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT520677	hsa-miR-3924	PAR-CLIP	21572407
MIRT520676	hsa-miR-297	PAR-CLIP	21572407
MIRT520675	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT508754	hsa-miR-8084	PAR-CLIP	21572407
MIRT508753	hsa-miR-1255a	PAR-CLIP	21572407
MIRT508752	hsa-miR-1255b-5p	PAR-CLIP	21572407
MIRT508751	hsa-miR-1206	PAR-CLIP	21572407
MIRT508750	hsa-miR-6516-3p	PAR-CLIP	21572407
MIRT498934	hsa-miR-4302	PAR-CLIP	21572407
MIRT498933	hsa-miR-4289	PAR-CLIP	21572407
MIRT498932	hsa-miR-145-3p	PAR-CLIP	21572407
MIRT498931	hsa-miR-7-5p	PAR-CLIP	21572407
MIRT498930	hsa-miR-6077	PAR-CLIP	21572407
MIRT498929	hsa-miR-3190-3p	PAR-CLIP	21572407
MIRT498928	hsa-miR-6833-5p	PAR-CLIP	21572407
MIRT498927	hsa-miR-4752	PAR-CLIP	21572407
MIRT498926	hsa-miR-670-3p	PAR-CLIP	21572407
MIRT508754	hsa-miR-8084	PAR-CLIP	21572407
MIRT508753	hsa-miR-1255a	PAR-CLIP	21572407
MIRT508752	hsa-miR-1255b-5p	PAR-CLIP	21572407
MIRT508751	hsa-miR-1206	PAR-CLIP	21572407
MIRT508750	hsa-miR-6516-3p	PAR-CLIP	21572407
MIRT508749	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT498934	hsa-miR-4302	PAR-CLIP	21572407
MIRT498933	hsa-miR-4289	PAR-CLIP	21572407
MIRT498932	hsa-miR-145-3p	PAR-CLIP	21572407
MIRT498931	hsa-miR-7-5p	PAR-CLIP	21572407
MIRT498930	hsa-miR-6077	PAR-CLIP	21572407
MIRT498929	hsa-miR-3190-3p	PAR-CLIP	21572407
MIRT498928	hsa-miR-6833-5p	PAR-CLIP	21572407
MIRT498927	hsa-miR-4752	PAR-CLIP	21572407
MIRT498926	hsa-miR-670-3p	PAR-CLIP	21572407
MIRT520681	hsa-miR-567	PAR-CLIP	23446348
MIRT520680	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT520679	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT520678	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT520677	hsa-miR-3924	PAR-CLIP	23446348
MIRT520676	hsa-miR-297	PAR-CLIP	23446348
MIRT520675	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT508754	hsa-miR-8084	PAR-CLIP	23446348
MIRT508753	hsa-miR-1255a	PAR-CLIP	23446348
MIRT508752	hsa-miR-1255b-5p	PAR-CLIP	23446348
MIRT508751	hsa-miR-1206	PAR-CLIP	23446348
MIRT508750	hsa-miR-6516-3p	PAR-CLIP	23446348
MIRT498934	hsa-miR-4302	PAR-CLIP	23446348
MIRT498933	hsa-miR-4289	PAR-CLIP	23446348
MIRT498932	hsa-miR-145-3p	PAR-CLIP	23446348
MIRT498931	hsa-miR-7-5p	PAR-CLIP	23446348
MIRT498930	hsa-miR-6077	PAR-CLIP	23446348
MIRT498929	hsa-miR-3190-3p	PAR-CLIP	23446348
MIRT498928	hsa-miR-6833-5p	PAR-CLIP	23446348
MIRT498927	hsa-miR-4752	PAR-CLIP	23446348
MIRT498926	hsa-miR-670-3p	PAR-CLIP	23446348
MIRT508754	hsa-miR-8084	PAR-CLIP	23446348
MIRT508753	hsa-miR-1255a	PAR-CLIP	23446348
MIRT508752	hsa-miR-1255b-5p	PAR-CLIP	23446348
MIRT508751	hsa-miR-1206	PAR-CLIP	23446348
MIRT508750	hsa-miR-6516-3p	PAR-CLIP	23446348
MIRT508749	hsa-miR-7156-3p	PAR-CLIP	23446348
MIRT498934	hsa-miR-4302	PAR-CLIP	24398324
MIRT498933	hsa-miR-4289	PAR-CLIP	24398324
MIRT498932	hsa-miR-145-3p	PAR-CLIP	24398324
MIRT498931	hsa-miR-7-5p	PAR-CLIP	24398324
MIRT498930	hsa-miR-6077	PAR-CLIP	24398324
MIRT498929	hsa-miR-3190-3p	PAR-CLIP	24398324
MIRT498928	hsa-miR-6833-5p	PAR-CLIP	24398324
MIRT498927	hsa-miR-4752	PAR-CLIP	24398324
MIRT498926	hsa-miR-670-3p	PAR-CLIP	24398324
MIRT449420	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT445005	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT449418	hsa-miR-3714	PAR-CLIP	22100165
MIRT449419	hsa-miR-1910-3p	PAR-CLIP	22100165
MIRT449417	hsa-miR-6511a-5p	PAR-CLIP	22100165
MIRT445004	hsa-miR-4738-3p	PAR-CLIP	22100165
MIRT445003	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT239476	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT445012	hsa-miR-148a-5p	PAR-CLIP	22100165
MIRT445010	hsa-miR-5584-3p	PAR-CLIP	22100165
MIRT445011	hsa-miR-4635	PAR-CLIP	22100165
MIRT239477	hsa-miR-1252-5p	PAR-CLIP	22100165
MIRT445009	hsa-miR-6124	PAR-CLIP	22100165
MIRT445008	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445007	hsa-miR-6126	PAR-CLIP	22100165
MIRT445006	hsa-miR-6864-5p	PAR-CLIP	22100165
MIRT445005	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445004	hsa-miR-4738-3p	PAR-CLIP	22100165
MIRT445003	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT1429629	hsa-miR-101	CLIP-seq
MIRT1429630	hsa-miR-1245b-3p	CLIP-seq
MIRT1429631	hsa-miR-1252	CLIP-seq
MIRT1429632	hsa-miR-1264	CLIP-seq
MIRT1429633	hsa-miR-1297	CLIP-seq
MIRT1429634	hsa-miR-1305	CLIP-seq
MIRT1429635	hsa-miR-134	CLIP-seq
MIRT1429636	hsa-miR-135a	CLIP-seq
MIRT1429637	hsa-miR-135b	CLIP-seq
MIRT1429638	hsa-miR-144	CLIP-seq
MIRT1429639	hsa-miR-154	CLIP-seq
MIRT1429640	hsa-miR-199a-3p	CLIP-seq
MIRT1429641	hsa-miR-199b-3p	CLIP-seq
MIRT1429642	hsa-miR-21	CLIP-seq
MIRT1429643	hsa-miR-2278	CLIP-seq
MIRT1429644	hsa-miR-2392	CLIP-seq
MIRT1429645	hsa-miR-26a	CLIP-seq
MIRT1429646	hsa-miR-26b	CLIP-seq
MIRT1429647	hsa-miR-3065-5p	CLIP-seq
MIRT1429648	hsa-miR-3115	CLIP-seq
MIRT1429649	hsa-miR-3118	CLIP-seq
MIRT1429650	hsa-miR-3129-5p	CLIP-seq
MIRT1429651	hsa-miR-3140-5p	CLIP-seq
MIRT1429652	hsa-miR-3148	CLIP-seq
MIRT1429653	hsa-miR-3163	CLIP-seq
MIRT1429654	hsa-miR-320a	CLIP-seq
MIRT1429655	hsa-miR-320b	CLIP-seq
MIRT1429656	hsa-miR-320c	CLIP-seq
MIRT1429657	hsa-miR-320d	CLIP-seq
MIRT1429658	hsa-miR-323-3p	CLIP-seq
MIRT1429659	hsa-miR-337-3p	CLIP-seq
MIRT1429660	hsa-miR-339-5p	CLIP-seq
MIRT1429661	hsa-miR-3622a-3p	CLIP-seq
MIRT1429662	hsa-miR-3622b-3p	CLIP-seq
MIRT1429663	hsa-miR-3646	CLIP-seq
MIRT1429664	hsa-miR-3674	CLIP-seq
MIRT1429665	hsa-miR-3682-5p	CLIP-seq
MIRT1429666	hsa-miR-3685	CLIP-seq
MIRT1429667	hsa-miR-384	CLIP-seq
MIRT1429668	hsa-miR-3938	CLIP-seq
MIRT1429669	hsa-miR-3940-5p	CLIP-seq
MIRT1429670	hsa-miR-3977	CLIP-seq
MIRT1429671	hsa-miR-412	CLIP-seq
MIRT1429672	hsa-miR-421	CLIP-seq
MIRT1429673	hsa-miR-4251	CLIP-seq
MIRT1429674	hsa-miR-4257	CLIP-seq
MIRT1429675	hsa-miR-4271	CLIP-seq
MIRT1429676	hsa-miR-4307	CLIP-seq
MIRT1429677	hsa-miR-4329	CLIP-seq
MIRT1429678	hsa-miR-4424	CLIP-seq
MIRT1429679	hsa-miR-4427	CLIP-seq
MIRT1429680	hsa-miR-4429	CLIP-seq
MIRT1429681	hsa-miR-4434	CLIP-seq
MIRT1429682	hsa-miR-4446-5p	CLIP-seq
MIRT1429683	hsa-miR-4464	CLIP-seq
MIRT1429684	hsa-miR-4465	CLIP-seq
MIRT1429685	hsa-miR-4477a	CLIP-seq
MIRT1429686	hsa-miR-4484	CLIP-seq
MIRT1429687	hsa-miR-4504	CLIP-seq
MIRT1429688	hsa-miR-4507	CLIP-seq
MIRT1429689	hsa-miR-4516	CLIP-seq
MIRT1429690	hsa-miR-4531	CLIP-seq
MIRT1429691	hsa-miR-4633-3p	CLIP-seq
MIRT1429692	hsa-miR-4680-3p	CLIP-seq
MIRT1429693	hsa-miR-4699-3p	CLIP-seq
MIRT1429694	hsa-miR-4703-3p	CLIP-seq
MIRT1429695	hsa-miR-4725-3p	CLIP-seq
MIRT1429696	hsa-miR-4748	CLIP-seq
MIRT1429697	hsa-miR-4755-5p	CLIP-seq
MIRT1429698	hsa-miR-4760-5p	CLIP-seq
MIRT1429699	hsa-miR-4762-3p	CLIP-seq
MIRT1429700	hsa-miR-4775	CLIP-seq
MIRT1429701	hsa-miR-4797-5p	CLIP-seq
MIRT1429702	hsa-miR-513a-3p	CLIP-seq
MIRT1429703	hsa-miR-548an	CLIP-seq
MIRT1429704	hsa-miR-548n	CLIP-seq
MIRT1429705	hsa-miR-548t	CLIP-seq
MIRT1429706	hsa-miR-563	CLIP-seq
MIRT1429707	hsa-miR-568	CLIP-seq
MIRT1429708	hsa-miR-579	CLIP-seq
MIRT1429709	hsa-miR-582-5p	CLIP-seq
MIRT1429710	hsa-miR-584	CLIP-seq
MIRT1429711	hsa-miR-590-3p	CLIP-seq
MIRT1429712	hsa-miR-590-5p	CLIP-seq
MIRT1429713	hsa-miR-629	CLIP-seq
MIRT1429714	hsa-miR-633	CLIP-seq
MIRT1429715	hsa-miR-670	CLIP-seq
MIRT1429716	hsa-miR-936	CLIP-seq
MIRT1429717	hsa-miR-944	CLIP-seq
MIRT1429636	hsa-miR-135a	CLIP-seq
MIRT1429637	hsa-miR-135b	CLIP-seq
MIRT1429644	hsa-miR-2392	CLIP-seq
MIRT1429718	hsa-miR-3120-3p	CLIP-seq
MIRT1429719	hsa-miR-3153	CLIP-seq
MIRT1429653	hsa-miR-3163	CLIP-seq
MIRT1429720	hsa-miR-3908	CLIP-seq
MIRT1429669	hsa-miR-3940-5p	CLIP-seq
MIRT1429721	hsa-miR-3942-5p	CLIP-seq
MIRT1429722	hsa-miR-4282	CLIP-seq
MIRT1429723	hsa-miR-4318	CLIP-seq
MIRT1429678	hsa-miR-4424	CLIP-seq
MIRT1429688	hsa-miR-4507	CLIP-seq
MIRT1429691	hsa-miR-4633-3p	CLIP-seq
MIRT1429724	hsa-miR-4648	CLIP-seq
MIRT1429725	hsa-miR-4654	CLIP-seq
MIRT1429726	hsa-miR-4668-5p	CLIP-seq
MIRT1429727	hsa-miR-4703-5p	CLIP-seq
MIRT1429728	hsa-miR-4766-3p	CLIP-seq
MIRT1429729	hsa-miR-4769-5p	CLIP-seq
MIRT1429730	hsa-miR-490-5p	CLIP-seq
MIRT1429702	hsa-miR-513a-3p	CLIP-seq
MIRT1429731	hsa-miR-545	CLIP-seq
MIRT1429732	hsa-miR-548c-3p	CLIP-seq
MIRT1429713	hsa-miR-629	CLIP-seq
MIRT1429714	hsa-miR-633	CLIP-seq
MIRT1429717	hsa-miR-944	CLIP-seq
MIRT2128755	hsa-miR-2054	CLIP-seq
MIRT2128756	hsa-miR-3613-5p	CLIP-seq
MIRT1429663	hsa-miR-3646	CLIP-seq
MIRT2128757	hsa-miR-4511	CLIP-seq
MIRT2128758	hsa-miR-4795-3p	CLIP-seq
MIRT2128759	hsa-miR-627	CLIP-seq
MIRT2128760	hsa-miR-924	CLIP-seq
MIRT1429717	hsa-miR-944	CLIP-seq
MIRT1429633	hsa-miR-1297	CLIP-seq
MIRT2128761	hsa-miR-221	CLIP-seq
MIRT2128762	hsa-miR-222	CLIP-seq
MIRT1429645	hsa-miR-26a	CLIP-seq
MIRT1429646	hsa-miR-26b	CLIP-seq
MIRT1429653	hsa-miR-3163	CLIP-seq
MIRT1429654	hsa-miR-320a	CLIP-seq
MIRT1429655	hsa-miR-320b	CLIP-seq
MIRT1429656	hsa-miR-320c	CLIP-seq
MIRT1429657	hsa-miR-320d	CLIP-seq
MIRT1429680	hsa-miR-4429	CLIP-seq
MIRT1429684	hsa-miR-4465	CLIP-seq
MIRT1429692	hsa-miR-4680-3p	CLIP-seq
MIRT1429693	hsa-miR-4699-3p	CLIP-seq
MIRT1429694	hsa-miR-4703-3p	CLIP-seq
MIRT2128763	hsa-miR-4719	CLIP-seq
MIRT1429732	hsa-miR-548c-3p	CLIP-seq
MIRT1429629	hsa-miR-101	CLIP-seq
MIRT2350248	hsa-miR-124	CLIP-seq
MIRT2350249	hsa-miR-1244	CLIP-seq
MIRT2350250	hsa-miR-125a-3p	CLIP-seq
MIRT2350251	hsa-miR-1262	CLIP-seq
MIRT2350252	hsa-miR-1269	CLIP-seq
MIRT2350253	hsa-miR-1269b	CLIP-seq
MIRT2350254	hsa-miR-1278	CLIP-seq
MIRT2350255	hsa-miR-1279	CLIP-seq
MIRT2350256	hsa-miR-129-5p	CLIP-seq
MIRT1429633	hsa-miR-1297	CLIP-seq
MIRT2350257	hsa-miR-132	CLIP-seq
MIRT1429635	hsa-miR-134	CLIP-seq
MIRT2350258	hsa-miR-137	CLIP-seq
MIRT1429638	hsa-miR-144	CLIP-seq
MIRT2350259	hsa-miR-193a-3p	CLIP-seq
MIRT2350260	hsa-miR-193b	CLIP-seq
MIRT2350261	hsa-miR-194	CLIP-seq
MIRT1429640	hsa-miR-199a-3p	CLIP-seq
MIRT1429641	hsa-miR-199b-3p	CLIP-seq
MIRT2350262	hsa-miR-19a	CLIP-seq
MIRT2350263	hsa-miR-19b	CLIP-seq
MIRT2128755	hsa-miR-2054	CLIP-seq
MIRT1429642	hsa-miR-21	CLIP-seq
MIRT2350264	hsa-miR-212	CLIP-seq
MIRT2350265	hsa-miR-214	CLIP-seq
MIRT2350266	hsa-miR-224	CLIP-seq
MIRT1429645	hsa-miR-26a	CLIP-seq
MIRT1429646	hsa-miR-26b	CLIP-seq
MIRT2350267	hsa-miR-28-3p	CLIP-seq
MIRT2350268	hsa-miR-302f	CLIP-seq
MIRT2350269	hsa-miR-3065-3p	CLIP-seq
MIRT2350270	hsa-miR-30a	CLIP-seq
MIRT2350271	hsa-miR-30b	CLIP-seq
MIRT2350272	hsa-miR-30c	CLIP-seq
MIRT2350273	hsa-miR-30d	CLIP-seq
MIRT2350274	hsa-miR-30e	CLIP-seq
MIRT1429648	hsa-miR-3115	CLIP-seq
MIRT1429649	hsa-miR-3118	CLIP-seq
MIRT2350275	hsa-miR-3121-5p	CLIP-seq
MIRT1429650	hsa-miR-3129-5p	CLIP-seq
MIRT2350276	hsa-miR-3145-5p	CLIP-seq
MIRT1429653	hsa-miR-3163	CLIP-seq
MIRT2350277	hsa-miR-3167	CLIP-seq
MIRT2350278	hsa-miR-3169	CLIP-seq
MIRT2350279	hsa-miR-3176	CLIP-seq
MIRT2350280	hsa-miR-3187-3p	CLIP-seq
MIRT2350281	hsa-miR-3200-5p	CLIP-seq
MIRT1429654	hsa-miR-320a	CLIP-seq
MIRT1429655	hsa-miR-320b	CLIP-seq
MIRT1429656	hsa-miR-320c	CLIP-seq
MIRT1429657	hsa-miR-320d	CLIP-seq
MIRT1429658	hsa-miR-323-3p	CLIP-seq
MIRT2350282	hsa-miR-323b-3p	CLIP-seq
MIRT2350283	hsa-miR-34b	CLIP-seq
MIRT2350284	hsa-miR-34c-3p	CLIP-seq
MIRT2350285	hsa-miR-3609	CLIP-seq
MIRT2350286	hsa-miR-3614-5p	CLIP-seq
MIRT2350287	hsa-miR-361-5p	CLIP-seq
MIRT2350288	hsa-miR-3616-5p	CLIP-seq
MIRT2350289	hsa-miR-3618	CLIP-seq
MIRT2350290	hsa-miR-3619-5p	CLIP-seq
MIRT1429663	hsa-miR-3646	CLIP-seq
MIRT2350291	hsa-miR-3647-5p	CLIP-seq
MIRT2350292	hsa-miR-3673	CLIP-seq
MIRT2350293	hsa-miR-3691-3p	CLIP-seq
MIRT2350294	hsa-miR-369-3p	CLIP-seq
MIRT2350295	hsa-miR-371-5p	CLIP-seq
MIRT2350296	hsa-miR-371b-5p	CLIP-seq
MIRT2350297	hsa-miR-374a	CLIP-seq
MIRT2350298	hsa-miR-374b	CLIP-seq
MIRT2350299	hsa-miR-374c	CLIP-seq
MIRT2350300	hsa-miR-3919	CLIP-seq
MIRT2350301	hsa-miR-3922-3p	CLIP-seq
MIRT1429668	hsa-miR-3938	CLIP-seq
MIRT1429670	hsa-miR-3977	CLIP-seq
MIRT2350302	hsa-miR-410	CLIP-seq
MIRT2350303	hsa-miR-4256	CLIP-seq
MIRT2350304	hsa-miR-4263	CLIP-seq
MIRT2350305	hsa-miR-4275	CLIP-seq
MIRT1429722	hsa-miR-4282	CLIP-seq
MIRT2350306	hsa-miR-4291	CLIP-seq
MIRT1429676	hsa-miR-4307	CLIP-seq
MIRT2350307	hsa-miR-4314	CLIP-seq
MIRT1429723	hsa-miR-4318	CLIP-seq
MIRT2350308	hsa-miR-4420	CLIP-seq
MIRT1429678	hsa-miR-4424	CLIP-seq
MIRT1429679	hsa-miR-4427	CLIP-seq
MIRT1429680	hsa-miR-4429	CLIP-seq
MIRT1429681	hsa-miR-4434	CLIP-seq
MIRT2350309	hsa-miR-4435	CLIP-seq
MIRT1429683	hsa-miR-4464	CLIP-seq
MIRT1429684	hsa-miR-4465	CLIP-seq
MIRT2350310	hsa-miR-4494	CLIP-seq
MIRT2350311	hsa-miR-4496	CLIP-seq
MIRT1429689	hsa-miR-4516	CLIP-seq
MIRT2350312	hsa-miR-4517	CLIP-seq
MIRT2350313	hsa-miR-4528	CLIP-seq
MIRT2350314	hsa-miR-4529-3p	CLIP-seq
MIRT1429690	hsa-miR-4531	CLIP-seq
MIRT2350315	hsa-miR-4633-5p	CLIP-seq
MIRT2350316	hsa-miR-4639-3p	CLIP-seq
MIRT1429724	hsa-miR-4648	CLIP-seq
MIRT2350317	hsa-miR-4670-3p	CLIP-seq
MIRT1429692	hsa-miR-4680-3p	CLIP-seq
MIRT2350318	hsa-miR-4682	CLIP-seq
MIRT1429693	hsa-miR-4699-3p	CLIP-seq
MIRT2350319	hsa-miR-4701-3p	CLIP-seq
MIRT2350320	hsa-miR-4701-5p	CLIP-seq
MIRT1429694	hsa-miR-4703-3p	CLIP-seq
MIRT2350321	hsa-miR-4705	CLIP-seq
MIRT2350322	hsa-miR-4729	CLIP-seq
MIRT2350323	hsa-miR-4731-3p	CLIP-seq
MIRT2350324	hsa-miR-4740-5p	CLIP-seq
MIRT2350325	hsa-miR-4746-3p	CLIP-seq
MIRT1429696	hsa-miR-4748	CLIP-seq
MIRT2350326	hsa-miR-4756-3p	CLIP-seq
MIRT2350327	hsa-miR-4760-3p	CLIP-seq
MIRT1429698	hsa-miR-4760-5p	CLIP-seq
MIRT1429699	hsa-miR-4762-3p	CLIP-seq
MIRT2350328	hsa-miR-4762-5p	CLIP-seq
MIRT2350329	hsa-miR-4795-5p	CLIP-seq
MIRT2350330	hsa-miR-4799-5p	CLIP-seq
MIRT2350331	hsa-miR-4801	CLIP-seq
MIRT2350332	hsa-miR-4802-5p	CLIP-seq
MIRT2350333	hsa-miR-483-3p	CLIP-seq
MIRT2350334	hsa-miR-485-3p	CLIP-seq
MIRT2350335	hsa-miR-487a	CLIP-seq
MIRT2350336	hsa-miR-489	CLIP-seq
MIRT1429730	hsa-miR-490-5p	CLIP-seq
MIRT2350337	hsa-miR-491-3p	CLIP-seq
MIRT2350338	hsa-miR-498	CLIP-seq
MIRT2350339	hsa-miR-499a-5p	CLIP-seq
MIRT2350340	hsa-miR-506	CLIP-seq
MIRT2350341	hsa-miR-508-5p	CLIP-seq
MIRT1429702	hsa-miR-513a-3p	CLIP-seq
MIRT2350342	hsa-miR-514	CLIP-seq
MIRT2350343	hsa-miR-514b-3p	CLIP-seq
MIRT2350344	hsa-miR-518a-5p	CLIP-seq
MIRT2350345	hsa-miR-520g	CLIP-seq
MIRT2350346	hsa-miR-520h	CLIP-seq
MIRT2350347	hsa-miR-527	CLIP-seq
MIRT2350348	hsa-miR-548aa	CLIP-seq
MIRT2350349	hsa-miR-548ah	CLIP-seq
MIRT1429732	hsa-miR-548c-3p	CLIP-seq
MIRT2350350	hsa-miR-548g	CLIP-seq
MIRT2350351	hsa-miR-548s	CLIP-seq
MIRT2350352	hsa-miR-552	CLIP-seq
MIRT1429706	hsa-miR-563	CLIP-seq
MIRT1429707	hsa-miR-568	CLIP-seq
MIRT2350353	hsa-miR-573	CLIP-seq
MIRT2350354	hsa-miR-576-5p	CLIP-seq
MIRT1429708	hsa-miR-579	CLIP-seq
MIRT2350355	hsa-miR-582-3p	CLIP-seq
MIRT1429709	hsa-miR-582-5p	CLIP-seq
MIRT1429710	hsa-miR-584	CLIP-seq
MIRT2350356	hsa-miR-588	CLIP-seq
MIRT1429711	hsa-miR-590-3p	CLIP-seq
MIRT1429712	hsa-miR-590-5p	CLIP-seq
MIRT2350357	hsa-miR-606	CLIP-seq
MIRT2350358	hsa-miR-607	CLIP-seq
MIRT2128759	hsa-miR-627	CLIP-seq
MIRT1429713	hsa-miR-629	CLIP-seq
MIRT2350359	hsa-miR-655	CLIP-seq
MIRT2350360	hsa-miR-671-5p	CLIP-seq
MIRT2350361	hsa-miR-761	CLIP-seq
MIRT2350362	hsa-miR-767-3p	CLIP-seq
MIRT2350363	hsa-miR-802	CLIP-seq
MIRT2350364	hsa-miR-873	CLIP-seq
MIRT2350365	hsa-miR-876-5p	CLIP-seq
MIRT2350366	hsa-miR-890	CLIP-seq
MIRT2350367	hsa-miR-922	CLIP-seq
MIRT2128760	hsa-miR-924	CLIP-seq
MIRT2350368	hsa-miR-934	CLIP-seq
MIRT1429629	hsa-miR-101	CLIP-seq
MIRT2643869	hsa-miR-105	CLIP-seq
MIRT1429630	hsa-miR-1245b-3p	CLIP-seq
MIRT1429631	hsa-miR-1252	CLIP-seq
MIRT2350254	hsa-miR-1278	CLIP-seq
MIRT1429633	hsa-miR-1297	CLIP-seq
MIRT1429634	hsa-miR-1305	CLIP-seq
MIRT1429638	hsa-miR-144	CLIP-seq
MIRT1429639	hsa-miR-154	CLIP-seq
MIRT2643870	hsa-miR-2681	CLIP-seq
MIRT1429645	hsa-miR-26a	CLIP-seq
MIRT1429646	hsa-miR-26b	CLIP-seq
MIRT2350269	hsa-miR-3065-3p	CLIP-seq
MIRT1429647	hsa-miR-3065-5p	CLIP-seq
MIRT2643871	hsa-miR-3135b	CLIP-seq
MIRT1429652	hsa-miR-3148	CLIP-seq
MIRT1429653	hsa-miR-3163	CLIP-seq
MIRT1429654	hsa-miR-320a	CLIP-seq
MIRT1429655	hsa-miR-320b	CLIP-seq
MIRT1429656	hsa-miR-320c	CLIP-seq
MIRT1429657	hsa-miR-320d	CLIP-seq
MIRT1429658	hsa-miR-323-3p	CLIP-seq
MIRT2643872	hsa-miR-331-5p	CLIP-seq
MIRT1429660	hsa-miR-339-5p	CLIP-seq
MIRT2643873	hsa-miR-340	CLIP-seq
MIRT2643874	hsa-miR-3545-3p	CLIP-seq
MIRT2350286	hsa-miR-3614-5p	CLIP-seq
MIRT1429663	hsa-miR-3646	CLIP-seq
MIRT2643875	hsa-miR-3652	CLIP-seq
MIRT2643876	hsa-miR-3653	CLIP-seq
MIRT2350292	hsa-miR-3673	CLIP-seq
MIRT2643877	hsa-miR-3688-3p	CLIP-seq
MIRT2350299	hsa-miR-374c	CLIP-seq
MIRT2643878	hsa-miR-3929	CLIP-seq
MIRT2350302	hsa-miR-410	CLIP-seq
MIRT1429672	hsa-miR-421	CLIP-seq
MIRT2350304	hsa-miR-4263	CLIP-seq
MIRT1429675	hsa-miR-4271	CLIP-seq
MIRT2643879	hsa-miR-4278	CLIP-seq
MIRT1429722	hsa-miR-4282	CLIP-seq
MIRT2643880	hsa-miR-4311	CLIP-seq
MIRT2350307	hsa-miR-4314	CLIP-seq
MIRT2643881	hsa-miR-4419b	CLIP-seq
MIRT1429680	hsa-miR-4429	CLIP-seq
MIRT2643882	hsa-miR-4430	CLIP-seq
MIRT2643883	hsa-miR-4433	CLIP-seq
MIRT1429681	hsa-miR-4434	CLIP-seq
MIRT1429682	hsa-miR-4446-5p	CLIP-seq
MIRT2643884	hsa-miR-4459	CLIP-seq
MIRT1429684	hsa-miR-4465	CLIP-seq
MIRT2643885	hsa-miR-4478	CLIP-seq
MIRT2643886	hsa-miR-450b-5p	CLIP-seq
MIRT1429689	hsa-miR-4516	CLIP-seq
MIRT1429690	hsa-miR-4531	CLIP-seq
MIRT1429691	hsa-miR-4633-3p	CLIP-seq
MIRT2643887	hsa-miR-4678	CLIP-seq
MIRT2643888	hsa-miR-4688	CLIP-seq
MIRT2643889	hsa-miR-4698	CLIP-seq
MIRT1429693	hsa-miR-4699-3p	CLIP-seq
MIRT1429695	hsa-miR-4725-3p	CLIP-seq
MIRT1429697	hsa-miR-4755-5p	CLIP-seq
MIRT1429698	hsa-miR-4760-5p	CLIP-seq
MIRT2643890	hsa-miR-4768-3p	CLIP-seq
MIRT2350330	hsa-miR-4799-5p	CLIP-seq
MIRT2350339	hsa-miR-499a-5p	CLIP-seq
MIRT2643891	hsa-miR-501-5p	CLIP-seq
MIRT2643892	hsa-miR-507	CLIP-seq
MIRT1429702	hsa-miR-513a-3p	CLIP-seq
MIRT2350344	hsa-miR-518a-5p	CLIP-seq
MIRT2350347	hsa-miR-527	CLIP-seq
MIRT1429732	hsa-miR-548c-3p	CLIP-seq
MIRT2643893	hsa-miR-557	CLIP-seq
MIRT1429707	hsa-miR-568	CLIP-seq
MIRT2643894	hsa-miR-570	CLIP-seq
MIRT2643895	hsa-miR-576-3p	CLIP-seq
MIRT2350354	hsa-miR-576-5p	CLIP-seq
MIRT1429709	hsa-miR-582-5p	CLIP-seq
MIRT2643896	hsa-miR-587	CLIP-seq
MIRT1429711	hsa-miR-590-3p	CLIP-seq
MIRT2643897	hsa-miR-595	CLIP-seq
MIRT2350358	hsa-miR-607	CLIP-seq
MIRT1429714	hsa-miR-633	CLIP-seq
MIRT2643898	hsa-miR-642b	CLIP-seq
MIRT2350359	hsa-miR-655	CLIP-seq
MIRT1429715	hsa-miR-670	CLIP-seq
MIRT2350366	hsa-miR-890	CLIP-seq
MIRT1429717	hsa-miR-944	CLIP-seq
MIRT1429653	hsa-miR-3163	CLIP-seq
MIRT2643873	hsa-miR-340	CLIP-seq
MIRT1429693	hsa-miR-4699-3p	CLIP-seq
MIRT2643891	hsa-miR-501-5p	CLIP-seq
MIRT2693345	hsa-miR-889	CLIP-seq
MIRT1429630	hsa-miR-1245b-3p	CLIP-seq
MIRT1429631	hsa-miR-1252	CLIP-seq
MIRT2350254	hsa-miR-1278	CLIP-seq
MIRT1429634	hsa-miR-1305	CLIP-seq
MIRT2350269	hsa-miR-3065-3p	CLIP-seq
MIRT1429647	hsa-miR-3065-5p	CLIP-seq
MIRT2643871	hsa-miR-3135b	CLIP-seq
MIRT1429653	hsa-miR-3163	CLIP-seq
MIRT1429660	hsa-miR-339-5p	CLIP-seq
MIRT2643873	hsa-miR-340	CLIP-seq
MIRT2350286	hsa-miR-3614-5p	CLIP-seq
MIRT1429663	hsa-miR-3646	CLIP-seq
MIRT2643875	hsa-miR-3652	CLIP-seq
MIRT2350292	hsa-miR-3673	CLIP-seq
MIRT2350299	hsa-miR-374c	CLIP-seq
MIRT2643878	hsa-miR-3929	CLIP-seq
MIRT2350302	hsa-miR-410	CLIP-seq
MIRT1429672	hsa-miR-421	CLIP-seq
MIRT1429675	hsa-miR-4271	CLIP-seq
MIRT2643879	hsa-miR-4278	CLIP-seq
MIRT1429722	hsa-miR-4282	CLIP-seq
MIRT2643881	hsa-miR-4419b	CLIP-seq
MIRT2643882	hsa-miR-4430	CLIP-seq
MIRT1429681	hsa-miR-4434	CLIP-seq
MIRT1429682	hsa-miR-4446-5p	CLIP-seq
MIRT2643885	hsa-miR-4478	CLIP-seq
MIRT1429689	hsa-miR-4516	CLIP-seq
MIRT1429690	hsa-miR-4531	CLIP-seq
MIRT1429691	hsa-miR-4633-3p	CLIP-seq
MIRT2643888	hsa-miR-4688	CLIP-seq
MIRT2643889	hsa-miR-4698	CLIP-seq
MIRT1429693	hsa-miR-4699-3p	CLIP-seq
MIRT1429695	hsa-miR-4725-3p	CLIP-seq
MIRT1429697	hsa-miR-4755-5p	CLIP-seq
MIRT1429698	hsa-miR-4760-5p	CLIP-seq
MIRT1429702	hsa-miR-513a-3p	CLIP-seq
MIRT2643894	hsa-miR-570	CLIP-seq
MIRT2643895	hsa-miR-576-3p	CLIP-seq
MIRT2350358	hsa-miR-607	CLIP-seq
MIRT2643898	hsa-miR-642b	CLIP-seq
MIRT2350359	hsa-miR-655	CLIP-seq
MIRT1429715	hsa-miR-670	CLIP-seq
MIRT2350366	hsa-miR-890	CLIP-seq
MIRT1429717	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	24357581, 32296183, 32814053, 35271311
GO:0005764	Component	Lysosome	IDA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IDA	24357581
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IDA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007040	Process	Lysosome organization	IBA
GO:0007040	Process	Lysosome organization	IEA
GO:0007041	Process	Lysosomal transport	IBA
GO:0007041	Process	Lysosomal transport	IEA
GO:0007042	Process	Lysosomal lumen acidification	IEA
GO:0016020	Component	Membrane	IEA
GO:0031902	Component	Late endosome membrane	IEA
GO:0032418	Process	Lysosome localization	IBA
GO:0032418	Process	Lysosome localization	IMP	24357581
GO:0048813	Process	Dendrite morphogenesis	IBA
GO:0048813	Process	Dendrite morphogenesis	IMP	24357581
GO:0051117	Function	ATPase binding	IEA
GO:0051117	Function	ATPase binding	IPI	28728022
GO:0070050	Process	Neuron cellular homeostasis	IEA
GO:1900006	Process	Positive regulation of dendrite development	IEA
GO:1905146	Process	Lysosomal protein catabolic process	IEA
GO:1905671	Process	Regulation of lysosome organization	IEA

Other IDs

• MIM: 613413
• HGNC: 22407
• e!Ensembl: ENSG00000106460

Protein

• UniProt ID: Q9NUM4
• Protein name: Transmembrane protein 106B
• Protein function: In neurons, involved in the transport of late endosomes/lysosomes (PubMed:25066864). May be involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking (PubMed:25066864). May act as a molecular brake for retrograde tra
• PDB: 7QVC, 7QVF, 7QWG, 7QWL, 7QWM, 7SAQ, 7SAR, 7SAS, 7TMC, 7U10, 7U11, 7U12, 7U13, 7U14, 7U15, 7U16, 7U17, 7U18, 7X83, 7X84, 8B7D, 8F9K, 8J7N, 8J7P, 8OTD, 8OTE, 8X5H, 9FNB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07092	DUF1356	27 → 258	Protein of unknown function (DUF1356)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the brain, including in the frontal cortex (at protein level) (PubMed:35247328, PubMed:35344985). Expressed in lung epithelial cells (PubMed:33686287). {ECO:0000269|PubMed:33686287, ECO:0000269|PubMed:35247328, ECO:0000269
• Sequence:

  MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEFTGRDSVT
  CPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRS
  IDVKYIGVKSAYVSYDVQKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKAR
  LNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHS
  EQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ

• Sequence length: 274

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Leukodystrophy, hypomyelinating, 16	Likely pathogenic; Pathogenic	rs1554310600	RCV000626490	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGIOEDEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA, VASCULAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EATING DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALIZED ANXIETY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC DILATED CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMYOSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TMEM106B-related disorder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular dementia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abulia	Abulia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25851827		★☆☆☆☆ Found in Text Mining only
Alexia	Alexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21220649, 24899141, 25653292, 25778476, 29970152, 31456032, 32492070, 33461566, 34854996, 36191742, 37726834, 37794492, 39273172	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	24166182		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	21104415, 23136129, 25085782		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	21104415, 23136129, 33314436, 34152475, 36012536, 40316175	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	28477711		★☆☆☆☆ Found in Text Mining only
Anomia	Anomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	28299358	Associate	★☆☆☆☆ Found in Text Mining only
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	ORPHANET_DG	21614538, 27543298		★☆☆☆☆ Found in Text Mining only
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	Orphanet			★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	27003218, 28460069		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	28330615	Associate	★☆☆☆☆ Found in Text Mining only
Broca Aphasia	Broca Aphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30013069		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	38514782	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	27003218, 28460069		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21104415, 23136129, 28330615, 30973966, 31456032, 34854996, 36012536	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28330615		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31709544		★☆☆☆☆ Found in Text Mining only
Compulsive hoarding	Compulsive Hoarding	HPO_DG			★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	29926172	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	26651479, 29056226, 30390709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	Pubtator	29056226, 30390709, 37726834	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Demyelinating Diseases	Demyelinating diseases	Pubtator	29186371	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	22895706		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyscalculia	Dyscalculia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysgraphia	Dysgraphia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysphasia	Dysphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontotemporal cerebral atrophy	Frontotemporal cerebral atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	20154673, 22511793, 22895706, 23742080, 24252750, 24343233, 24385136, 24442578, 25085782, 25096617, 25778476, 26358247, 27126638, 27543298, 27563066, 28330615, 28460069, 28477711, 28728022, 28888721, 29186371, 29855382, 29929528, 30496365, 30973966, 31119452		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	23742080, 24385136, 25778476, 28330615, 28460069, 29186371, 30973966, 33461566, 36012536, 37530644, 37726834, 39321401	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontotemporal dementia	Frontotemporal dementia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Frontotemporal Lobar Degeneration	Frontotemporal dementia	CTD_human_DG	20154673		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	21104415, 21178100, 21220649, 21354975, 21614538, 22511793, 24166182, 24252750, 24442578, 24619111, 24731779, 24872421, 24899141, 25085782, 25096617, 25653292, 26651479, 27563066, 28126008, 28728022, 29724592, 29970152, 31456032		★☆☆☆☆ Found in Text Mining only
Grammar-specific speech disorder	Grammar-specific speech disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	25480889		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25480889	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	29186371	Associate	★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21104415, 23136129, 28330615, 30973966		★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	BEFREE	29186371		★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	29194508	Associate	★☆☆☆☆ Found in Text Mining only
LEUKODYSTROPHY, HYPOMYELINATING, 16	Hypomyelinating Leukodystrophy	GENOMICS_ENGLAND_DG	29186371		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LEUKODYSTROPHY, HYPOMYELINATING, 16	Hypomyelinating Leukodystrophy	UNIPROT_DG	29186371, 29444210		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
LEUKODYSTROPHY, HYPOMYELINATING, 16	Hypomyelinating Leukodystrophy	CLINVAR_DG	29186371, 29444210		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29662059, 29700475, 29942085, 30718901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of lung	Lung Cancer	BEFREE	30013069		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30013069		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	22895706		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	24385136		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22511793, 25480889, 29970152, 30332472, 30390709, 33314436, 37100087, 37530644, 39321401	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24252750, 26651479, 28477711, 28728022, 29970152, 30332472, 30390709, 31456032		★☆☆☆☆ Found in Text Mining only
Neuronal Ceroid-Lipofuscinoses	Neuronal Ceroid Lipofuscinosis	BEFREE	24619111		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25851827		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28477711, 30973966		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	30973966, 37726834, 38514782, 40053464	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	22895706, 23742080, 25096617, 25778476, 27126638, 28330615, 28460069, 28728022, 28888721, 29186371, 29855382, 30496365, 30973966		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29056226, 30390709		★☆☆☆☆ Found in Text Mining only
Primary Progressive Nonfluent Aphasia	Nonfluent Aphasia	ORPHANET_DG	21614538, 27543298		★☆☆☆☆ Found in Text Mining only
Progressive non-fluent aphasia	Progressive Non-Fluent Aphasia	Orphanet			★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	29970152		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	38514782	Associate	★☆☆☆☆ Found in Text Mining only
Semantic Dementia	Semantic Dementia	ORPHANET_DG	21614538, 27543298		★☆☆☆☆ Found in Text Mining only
Semantic dementia	Semantic Dementia	Orphanet			★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	31376286	Associate	★☆☆☆☆ Found in Text Mining only
Stereotyped Behavior	Stereotyped Behavior	HPO_DG			★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	29970152	Associate	★☆☆☆☆ Found in Text Mining only
Temporal cortical atrophy	Temporal cortical atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	35344984	Associate	★☆☆☆☆ Found in Text Mining only