Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	54622
Gene name	ARF like GTPase 15
Gene symbol	ARL15
Synonyms (NCBI Gene)	ARFRP2
Chromosome	5
Chromosome location	5q11.2

114

Show/Hide all (114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005226	hsa-let-7b-5p	pSILAC	18668040
MIRT016085	hsa-miR-744-5p	Sequencing	20371350
MIRT020858	hsa-miR-155-5p	Proteomics	18668040
MIRT020858	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT021621	hsa-miR-142-3p	Microarray	17612493
MIRT025799	hsa-miR-7-5p	Sequencing	20371350
MIRT005226	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT021621	hsa-miR-142-3p	PAR-CLIP	22100165
MIRT448994	hsa-miR-3129-5p	PAR-CLIP	22100165
MIRT448993	hsa-miR-199a-3p	PAR-CLIP	22100165
MIRT448992	hsa-miR-199b-3p	PAR-CLIP	22100165
MIRT448991	hsa-miR-648	PAR-CLIP	22100165
MIRT448990	hsa-miR-936	PAR-CLIP	22100165
MIRT448988	hsa-miR-4797-3p	PAR-CLIP	22100165
MIRT448989	hsa-miR-4264	PAR-CLIP	22100165
MIRT448987	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT450971	hsa-miR-6817-3p	PAR-CLIP	22100165
MIRT448986	hsa-miR-3177-5p	PAR-CLIP	22100165
MIRT238555	hsa-miR-222-5p	PAR-CLIP	22100165
MIRT450970	hsa-miR-6873-3p	PAR-CLIP	22100165
MIRT021621	hsa-miR-142-3p	PAR-CLIP	22100165
MIRT448994	hsa-miR-3129-5p	PAR-CLIP	22100165
MIRT448993	hsa-miR-199a-3p	PAR-CLIP	22100165
MIRT448992	hsa-miR-199b-3p	PAR-CLIP	22100165
MIRT448991	hsa-miR-648	PAR-CLIP	22100165
MIRT448990	hsa-miR-936	PAR-CLIP	22100165
MIRT448988	hsa-miR-4797-3p	PAR-CLIP	22100165
MIRT448989	hsa-miR-4264	PAR-CLIP	22100165
MIRT448987	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT448986	hsa-miR-3177-5p	PAR-CLIP	22100165
MIRT238555	hsa-miR-222-5p	PAR-CLIP	22100165
MIRT021621	hsa-miR-142-3p	PAR-CLIP	22100165
MIRT448994	hsa-miR-3129-5p	PAR-CLIP	22100165
MIRT448993	hsa-miR-199a-3p	PAR-CLIP	22100165
MIRT448992	hsa-miR-199b-3p	PAR-CLIP	22100165
MIRT448991	hsa-miR-648	PAR-CLIP	22100165
MIRT448990	hsa-miR-936	PAR-CLIP	22100165
MIRT448988	hsa-miR-4797-3p	PAR-CLIP	22100165
MIRT448989	hsa-miR-4264	PAR-CLIP	22100165
MIRT448987	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT450971	hsa-miR-6817-3p	PAR-CLIP	22100165
MIRT448986	hsa-miR-3177-5p	PAR-CLIP	22100165
MIRT238555	hsa-miR-222-5p	PAR-CLIP	22100165
MIRT450970	hsa-miR-6873-3p	PAR-CLIP	22100165
MIRT021621	hsa-miR-142-3p	PAR-CLIP	22100165
MIRT448994	hsa-miR-3129-5p	PAR-CLIP	22100165
MIRT448993	hsa-miR-199a-3p	PAR-CLIP	22100165
MIRT448992	hsa-miR-199b-3p	PAR-CLIP	22100165
MIRT448991	hsa-miR-648	PAR-CLIP	22100165
MIRT448990	hsa-miR-936	PAR-CLIP	22100165
MIRT448988	hsa-miR-4797-3p	PAR-CLIP	22100165
MIRT448989	hsa-miR-4264	PAR-CLIP	22100165
MIRT448987	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT448986	hsa-miR-3177-5p	PAR-CLIP	22100165
MIRT238555	hsa-miR-222-5p	PAR-CLIP	22100165
MIRT797551	hsa-miR-1252	CLIP-seq
MIRT797552	hsa-miR-140-5p	CLIP-seq
MIRT797553	hsa-miR-186	CLIP-seq
MIRT797554	hsa-miR-30a	CLIP-seq
MIRT797555	hsa-miR-30b	CLIP-seq
MIRT797556	hsa-miR-30c	CLIP-seq
MIRT797557	hsa-miR-30d	CLIP-seq
MIRT797558	hsa-miR-30e	CLIP-seq
MIRT797559	hsa-miR-3123	CLIP-seq
MIRT797560	hsa-miR-3133	CLIP-seq
MIRT797561	hsa-miR-3545-5p	CLIP-seq
MIRT797562	hsa-miR-3919	CLIP-seq
MIRT797563	hsa-miR-4271	CLIP-seq
MIRT797564	hsa-miR-4460	CLIP-seq
MIRT797565	hsa-miR-4706	CLIP-seq
MIRT797566	hsa-miR-4725-3p	CLIP-seq
MIRT797567	hsa-miR-4727-3p	CLIP-seq
MIRT797568	hsa-miR-4749-5p	CLIP-seq
MIRT797569	hsa-miR-744	CLIP-seq
MIRT1935537	hsa-miR-139-5p	CLIP-seq
MIRT1935538	hsa-miR-3682-3p	CLIP-seq
MIRT1935539	hsa-miR-4768-5p	CLIP-seq
MIRT1935540	hsa-miR-4778-5p	CLIP-seq
MIRT1935541	hsa-miR-511	CLIP-seq
MIRT2175613	hsa-miR-3125	CLIP-seq
MIRT2175614	hsa-miR-3662	CLIP-seq
MIRT2175615	hsa-miR-3916	CLIP-seq
MIRT2175616	hsa-miR-4760-3p	CLIP-seq
MIRT1935539	hsa-miR-4768-5p	CLIP-seq
MIRT2443969	hsa-miR-1178	CLIP-seq
MIRT2443970	hsa-miR-3907	CLIP-seq
MIRT2443971	hsa-miR-4670-3p	CLIP-seq
MIRT2443969	hsa-miR-1178	CLIP-seq
MIRT2478867	hsa-miR-1207-5p	CLIP-seq
MIRT2478868	hsa-miR-1245b-3p	CLIP-seq
MIRT2478869	hsa-miR-1253	CLIP-seq
MIRT2478870	hsa-miR-183	CLIP-seq
MIRT2478871	hsa-miR-3152-5p	CLIP-seq
MIRT2478872	hsa-miR-380	CLIP-seq
MIRT2443970	hsa-miR-3907	CLIP-seq
MIRT2478873	hsa-miR-3942-3p	CLIP-seq
MIRT2478874	hsa-miR-4289	CLIP-seq
MIRT2478875	hsa-miR-4311	CLIP-seq
MIRT2478876	hsa-miR-4736	CLIP-seq
MIRT2478877	hsa-miR-4763-3p	CLIP-seq
MIRT1935539	hsa-miR-4768-5p	CLIP-seq
MIRT2478878	hsa-miR-494	CLIP-seq
MIRT1935541	hsa-miR-511	CLIP-seq
MIRT2478879	hsa-miR-570	CLIP-seq
MIRT2478880	hsa-miR-590-3p	CLIP-seq
MIRT2478868	hsa-miR-1245b-3p	CLIP-seq
MIRT2478869	hsa-miR-1253	CLIP-seq
MIRT2478872	hsa-miR-380	CLIP-seq
MIRT2478873	hsa-miR-3942-3p	CLIP-seq
MIRT2478874	hsa-miR-4289	CLIP-seq
MIRT2478875	hsa-miR-4311	CLIP-seq
MIRT2478878	hsa-miR-494	CLIP-seq
MIRT1935541	hsa-miR-511	CLIP-seq
MIRT2478879	hsa-miR-570	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003674	Function	Molecular_function	ND
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	16169070, 32296183
GO:0005525	Function	GTP binding	IEA
GO:0008150	Process	Biological_process	ND
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9NXU5

Protein name

ADP-ribosylation factor-like protein 15 (ADP-ribosylation factor-related protein 2) (ARF-related protein 2)

PDB

8F6D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00025	Arf	27 → 194	ADP-ribosylation factor family	Domain

Sequence

MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNV
VSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAAR
NELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDM
DALKDSFSQLINLLEEKDHEAVRM

Sequence length

204

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARL15-related disorder	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARRETT'S ESOPHAGUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23918589, 34187973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37551622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36302536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21036322, 30682341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21036322		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	20011104, 21036322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28322786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27554474	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28322786		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24688318, 25799151, 27554474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20011104, 27115357, 30130595, 30682341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	24509480, 28869590, 30054458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	24509480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	31623319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	29242557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29242557, 29465355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18485879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31623319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31623319, 33983957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23918589, 29465355		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

ARL15 (ARF like GTPase 15)