UGT1A6 (UDP glucuronosyltransferase family 1 member A6)

Gene

• Entrez ID: 54578
• Gene name: UDP glucuronosyltransferase family 1 member A6
• Gene symbol: UGT1A6
• Synonyms (NCBI Gene): GNT1, HLUGP, HLUGP1, UDPGT, UDPGT 1-6, UGT-1A, UGT-1C, UGT-1E, UGT-1F, UGT1, UGT1-01, UGT1-03, UGT1-05, UGT1-06, UGT1.1, UGT1.3, UGT1.5, UGT1.6, UGT1A, UGT1A1, UGT1A3, UGT1A5, UGT1A6S, UGT1C, UGT1E, UGT1F, hUG-BR1
• Chromosome: 2
• Chromosome location: 2q37.1
• Summary: This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1473453	hsa-miR-1202	CLIP-seq
MIRT1473454	hsa-miR-136	CLIP-seq
MIRT1473455	hsa-miR-3120-5p	CLIP-seq
MIRT1473456	hsa-miR-3130-3p	CLIP-seq
MIRT1473457	hsa-miR-3194-5p	CLIP-seq
MIRT1473458	hsa-miR-346	CLIP-seq
MIRT1473459	hsa-miR-3909	CLIP-seq
MIRT1473460	hsa-miR-3940-5p	CLIP-seq
MIRT1473461	hsa-miR-3972	CLIP-seq
MIRT1473462	hsa-miR-4288	CLIP-seq
MIRT1473463	hsa-miR-4421	CLIP-seq
MIRT1473464	hsa-miR-4507	CLIP-seq
MIRT1473465	hsa-miR-4766-5p	CLIP-seq
MIRT1473466	hsa-miR-4793-3p	CLIP-seq
MIRT1473467	hsa-miR-489	CLIP-seq
MIRT1473468	hsa-miR-514	CLIP-seq
MIRT1473469	hsa-miR-514b-3p	CLIP-seq
MIRT1473470	hsa-miR-548a-5p	CLIP-seq
MIRT1473471	hsa-miR-548ab	CLIP-seq
MIRT1473472	hsa-miR-548ak	CLIP-seq
MIRT1473473	hsa-miR-548b-5p	CLIP-seq
MIRT1473474	hsa-miR-548c-5p	CLIP-seq
MIRT1473475	hsa-miR-548d-5p	CLIP-seq
MIRT1473476	hsa-miR-548h	CLIP-seq
MIRT1473477	hsa-miR-548i	CLIP-seq
MIRT1473478	hsa-miR-548j	CLIP-seq
MIRT1473479	hsa-miR-548n	CLIP-seq
MIRT1473480	hsa-miR-548w	CLIP-seq
MIRT1473481	hsa-miR-548y	CLIP-seq
MIRT1473482	hsa-miR-559	CLIP-seq
MIRT1473483	hsa-miR-629	CLIP-seq
MIRT1473484	hsa-miR-632	CLIP-seq
MIRT2142604	hsa-miR-579	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AHR	Unknown	9466822
ARNT	Unknown	20854796

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IDA	20308471
GO:0004857	Function	Enzyme inhibitor activity	ISS	20610558
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	17179145
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	NAS	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IKR	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	20610558
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006805	Process	Xenobiotic metabolic process	IDA	3141926
GO:0006805	Process	Xenobiotic metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IKR	20610558
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0008194	Function	UDP-glycosyltransferase activity	IEA
GO:0015020	Function	Glucuronosyltransferase activity	IDA	15231852, 21422672, 22579593
GO:0015020	Function	Glucuronosyltransferase activity	IEA
GO:0015020	Function	Glucuronosyltransferase activity	IKR	20610558
GO:0015020	Function	Glucuronosyltransferase activity	ISS	20610558
GO:0015020	Function	Glucuronosyltransferase activity	TAS
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0019899	Function	Enzyme binding	IBA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	17179145, 20610558
GO:0042803	Function	Protein homodimerization activity	IDA	17179145
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045922	Process	Negative regulation of fatty acid metabolic process	ISS	20610558
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	20610558

Other IDs

• MIM: 606431
• HGNC: 12538
• e!Ensembl: ENSG00000167165

Protein

• UniProt ID: P19224
• Protein name: UDP-glucuronosyltransferase 1A6 (UGT1A6) (EC 2.4.1.17) (Phenol-metabolizing UDP-glucuronosyltransferase) (UDP-glucuronosyltransferase 1-6) (UDPGT 1-6) (UGT1*6) (UGT1-06) (UGT1.6) (UDP-glucuronosyltransferase 1-F) (UGT-1F) (UGT1F)
• Protein function: [Isoform 1]: UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to facilitate their inactivation and excretion from the body (PubMed:15231852,
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00201	UDPGT	27 → 523	UDP-glucoronosyl and UDP-glucosyl transferase	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in skin. Isoforms 1 and 3 are expressed in kidney and liver. Isoform 1 but not isoform 2 is expressed in colon, esophagus and small intestine. {ECO:0000269|PubMed:1339448, ECO:0000269|PubMed:18004212}.
• Sequence:

  MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVV
  PEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIG
  LYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEH
  TFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRD
  VDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCKKRKDLSQEFEAYINASGEHG
  IVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLL
  GHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSE
  DLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDL
  TWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

• Sequence length: 532

Pathways

KEGG:

Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Retinol metabolism
Porphyrin metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Biosynthesis of cofactors
Bile secretion
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation

Reactome:

Glucuronidation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIRUBIN METABOLISM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRIGLER NAJJAR SYNDROME, TYPE 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRIGLER NAJJAR SYNDROME, TYPE 2	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRIGLER-NAJJAR SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILBERT DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUCEY-DRISCOLL SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERINATAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	15770010, 19437564, 22030088		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	15770010, 16797247, 17085674, 22030088		★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	27557546		★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	27557546		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	12850481, 18392554		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	GWASCAT_DG	22558097		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19575027		★☆☆☆☆ Found in Text Mining only
Asthma, Aspirin-Induced	Asthma	BEFREE	14586772		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24057187		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	18081723, 19021734, 9375768		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	18081723, 9375768		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19880377		★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	28841884	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20854796		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34886806	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	22450351	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27690298		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19880377		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22912755, 9466822		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36571650	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	26968791	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26517138		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26517138	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	29713898		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	11425418, 11843828, 14555305, 21319362		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	11425418, 11843828, 14555305, 16237771, 18081723, 19021734, 21319362, 24204915		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholelithiasis	Cholelithiasis	GWASDB_DG	22558097		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholelithiasis	Cholelithiasis	GWASCAT_DG	22558097		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholestasis	BEFREE	29867509		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19437564, 9466822		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15319294, 16141797, 16797247, 20965940, 21310730, 22901212, 24677636, 26710796, 29425227		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15319294		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24677636	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31698983	Associate	★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	16305586		★☆☆☆☆ Found in Text Mining only
Crigler Najjar syndrome, type 1	Crigler-Najjar syndrome	BEFREE	11013440, 12378576, 18180294, 19845429, 23403257, 7614251, 7906695, 7989045, 9039987, 9156798, 9435989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crigler Najjar syndrome, type 1	Crigler-Najjar syndrome	CLINVAR_DG	11182932, 15712364, 26697581		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crigler Najjar syndrome, type 2	Crigler-Najjar syndrome	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	10541948, 27557546		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26628212		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	28817838	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	21317830		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	23099353, 23749495, 25751467, 27855134		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	23099353, 25751467	Associate	★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	26039129	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastritis	Gastritis	BEFREE	26517138		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	19415281, 23963147	Associate	★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	Pubtator	31075877	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	30822514		★☆☆☆☆ Found in Text Mining only
Generalized glycogen storage disease of infants	Glycogen Storage Disease	BEFREE	28363873		★☆☆☆☆ Found in Text Mining only
Gilbert Disease	Gilbert syndrome	Pubtator	22450351	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gilbert Disease (disorder)	Gilbert Disease	BEFREE	10541948, 10583252, 11843828, 11915038, 12012638, 12068798, 12732365, 14663278, 15858133, 17496722, 19021734, 19845429, 19932091, 20177420, 20194756, 21309756, 21319362, 22160004, 22398043, 24785582, 26781906, 31017737, 8596320, 9375768		★☆☆☆☆ Found in Text Mining only
Gilbert Disease (disorder)	Gilbert Disease	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	28363873		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	22715028		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	29695616	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	BEFREE	14663278, 21319362		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	10541948, 15319464, 16609363, 18043502, 20194756, 20504240, 20890421, 21309756, 21592495, 21983082, 21993917, 23130636, 23609856, 24204915, 24785582, 26039129, 26480925, 26859599, 9156798, 9748558		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	Pubtator	26039129, 39457450	Associate	★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia, Neonatal	Hyperbilirubinemia	BEFREE	10541948, 21983082, 24104695, 26342858, 28025333, 28340583		★☆☆☆☆ Found in Text Mining only
Kernicterus	Kernicterus	BEFREE	28167773		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	15007088, 20653675, 25778466, 26352872, 26710796, 28817838		★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	23408116	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	9230212		★☆☆☆☆ Found in Text Mining only
Lucey-Driscoll syndrome (disorder)	Lucey-Driscoll syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22912755	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	27197003		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	22715028		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20854796		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22912755		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20308029, 25452636		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23303296		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19880377		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11170257, 30307765, 30724669		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19437564		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18180294		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASCAT_DG	30621171		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	23609856		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	16305586		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15318931, 15709193, 17085674, 23963147, 25899702		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	15007088, 20653675, 25778466, 26352872, 26710796, 28817838		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	20860988	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28098838		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	GWASCAT_DG	25246029		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34595239	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	15247627		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20308029, 25452636		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21993917		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	20096102, 25778466, 28474802		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	28841884	Associate	★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29131354		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23303296		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25712374	Stimulate	★☆☆☆☆ Found in Text Mining only
Thalassemia Intermedia	Thalassemia	BEFREE	12850481		★☆☆☆☆ Found in Text Mining only
Unconjugated hyperbilirubinemia	Hyperbilirubinemia	BEFREE	12439228, 15864125, 15965581, 18781851, 26781906, 9435989		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23536561	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	17549067		★☆☆☆☆ Found in Text Mining only