Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54566
Gene name	Erythrocyte membrane protein band 4.1 like 4B
Gene symbol	EPB41L4B
Synonyms (NCBI Gene)	CG1EHM2LULU2
Chromosome	9
Chromosome location	9q31.3

182

Show/Hide all (182)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002739	hsa-miR-1-3p	Microarray	18668037
MIRT002739	hsa-miR-1-3p	Microarray	15685193
MIRT658595	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT658594	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT658593	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT658592	hsa-miR-29b-1-5p	HITS-CLIP	23824327
MIRT658591	hsa-miR-3182	HITS-CLIP	23824327
MIRT658590	hsa-miR-4663	HITS-CLIP	23824327
MIRT658589	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT658588	hsa-miR-8077	HITS-CLIP	23824327
MIRT550652	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT550651	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT550650	hsa-miR-1323	PAR-CLIP	21572407
MIRT550649	hsa-miR-548o-3p	PAR-CLIP	21572407
MIRT550648	hsa-miR-105-5p	PAR-CLIP	21572407
MIRT550647	hsa-miR-7853-5p	PAR-CLIP	21572407
MIRT550646	hsa-miR-31-3p	PAR-CLIP	21572407
MIRT550645	hsa-miR-3658	PAR-CLIP	21572407
MIRT455461	hsa-miR-3662	PAR-CLIP	23592263
MIRT455460	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT455459	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT455458	hsa-miR-1245b-3p	PAR-CLIP	23592263
MIRT455457	hsa-miR-627-3p	PAR-CLIP	23592263
MIRT455456	hsa-miR-7515	PAR-CLIP	23592263
MIRT455455	hsa-miR-3179	PAR-CLIP	23592263
MIRT455454	hsa-miR-5093	PAR-CLIP	23592263
MIRT455453	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT455452	hsa-miR-4271	PAR-CLIP	23592263
MIRT455451	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT455450	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT455449	hsa-miR-5100	PAR-CLIP	23592263
MIRT455448	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT455447	hsa-miR-2110	PAR-CLIP	23592263
MIRT455446	hsa-miR-3942-3p	PAR-CLIP	23592263
MIRT455445	hsa-miR-30a-3p	PAR-CLIP	23592263
MIRT455444	hsa-miR-30d-3p	PAR-CLIP	23592263
MIRT455443	hsa-miR-30e-3p	PAR-CLIP	23592263
MIRT735138	hsa-miR-15b-5p	MicroarrayqRT-PCRFlow cytometry	32661467
MIRT658595	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT658594	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT658593	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT658592	hsa-miR-29b-1-5p	HITS-CLIP	23824327
MIRT658591	hsa-miR-3182	HITS-CLIP	23824327
MIRT658590	hsa-miR-4663	HITS-CLIP	23824327
MIRT658589	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT658588	hsa-miR-8077	HITS-CLIP	23824327
MIRT550652	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT550651	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT550650	hsa-miR-1323	PAR-CLIP	21572407
MIRT550649	hsa-miR-548o-3p	PAR-CLIP	21572407
MIRT550648	hsa-miR-105-5p	PAR-CLIP	21572407
MIRT550647	hsa-miR-7853-5p	PAR-CLIP	21572407
MIRT550646	hsa-miR-31-3p	PAR-CLIP	21572407
MIRT550645	hsa-miR-3658	PAR-CLIP	21572407
MIRT455461	hsa-miR-3662	PAR-CLIP	23592263
MIRT455460	hsa-miR-1252-3p	PAR-CLIP	23592263
MIRT455459	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT455458	hsa-miR-1245b-3p	PAR-CLIP	23592263
MIRT455457	hsa-miR-627-3p	PAR-CLIP	23592263
MIRT455456	hsa-miR-7515	PAR-CLIP	23592263
MIRT455455	hsa-miR-3179	PAR-CLIP	23592263
MIRT455454	hsa-miR-5093	PAR-CLIP	23592263
MIRT455453	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT455452	hsa-miR-4271	PAR-CLIP	23592263
MIRT455451	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT455450	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT455449	hsa-miR-5100	PAR-CLIP	23592263
MIRT455448	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT455447	hsa-miR-2110	PAR-CLIP	23592263
MIRT455446	hsa-miR-3942-3p	PAR-CLIP	23592263
MIRT455445	hsa-miR-30a-3p	PAR-CLIP	23592263
MIRT455444	hsa-miR-30d-3p	PAR-CLIP	23592263
MIRT455443	hsa-miR-30e-3p	PAR-CLIP	23592263
MIRT965734	hsa-miR-1	CLIP-seq
MIRT965735	hsa-miR-103a	CLIP-seq
MIRT965736	hsa-miR-107	CLIP-seq
MIRT965737	hsa-miR-1279	CLIP-seq
MIRT965738	hsa-miR-15a	CLIP-seq
MIRT965739	hsa-miR-15b	CLIP-seq
MIRT965740	hsa-miR-16	CLIP-seq
MIRT965741	hsa-miR-195	CLIP-seq
MIRT965742	hsa-miR-206	CLIP-seq
MIRT965743	hsa-miR-208a	CLIP-seq
MIRT965744	hsa-miR-208b	CLIP-seq
MIRT965745	hsa-miR-297	CLIP-seq
MIRT965746	hsa-miR-29a	CLIP-seq
MIRT965747	hsa-miR-29b	CLIP-seq
MIRT965748	hsa-miR-29c	CLIP-seq
MIRT965749	hsa-miR-3065-3p	CLIP-seq
MIRT965750	hsa-miR-3149	CLIP-seq
MIRT965751	hsa-miR-361-3p	CLIP-seq
MIRT965752	hsa-miR-3617	CLIP-seq
MIRT965753	hsa-miR-3660	CLIP-seq
MIRT965754	hsa-miR-3673	CLIP-seq
MIRT965755	hsa-miR-3938	CLIP-seq
MIRT965756	hsa-miR-424	CLIP-seq
MIRT965757	hsa-miR-4256	CLIP-seq
MIRT965758	hsa-miR-4302	CLIP-seq
MIRT965759	hsa-miR-4436b-3p	CLIP-seq
MIRT965760	hsa-miR-4468	CLIP-seq
MIRT965761	hsa-miR-4524	CLIP-seq
MIRT965762	hsa-miR-4526	CLIP-seq
MIRT965763	hsa-miR-4645-3p	CLIP-seq
MIRT965764	hsa-miR-4729	CLIP-seq
MIRT965765	hsa-miR-4738-3p	CLIP-seq
MIRT965766	hsa-miR-4761-3p	CLIP-seq
MIRT965767	hsa-miR-4766-5p	CLIP-seq
MIRT965768	hsa-miR-490-5p	CLIP-seq
MIRT965769	hsa-miR-497	CLIP-seq
MIRT965770	hsa-miR-499-5p	CLIP-seq
MIRT965771	hsa-miR-503	CLIP-seq
MIRT965772	hsa-miR-513b	CLIP-seq
MIRT965773	hsa-miR-545	CLIP-seq
MIRT965774	hsa-miR-548c-3p	CLIP-seq
MIRT965775	hsa-miR-613	CLIP-seq
MIRT965776	hsa-miR-630	CLIP-seq
MIRT965777	hsa-miR-641	CLIP-seq
MIRT965778	hsa-miR-646	CLIP-seq
MIRT965779	hsa-miR-654-3p	CLIP-seq
MIRT965780	hsa-miR-944	CLIP-seq
MIRT965781	hsa-miR-132	CLIP-seq
MIRT965782	hsa-miR-138	CLIP-seq
MIRT965783	hsa-miR-145	CLIP-seq
MIRT965784	hsa-miR-146b-3p	CLIP-seq
MIRT965785	hsa-miR-1825	CLIP-seq
MIRT965786	hsa-miR-199a-5p	CLIP-seq
MIRT965787	hsa-miR-199b-5p	CLIP-seq
MIRT965788	hsa-miR-212	CLIP-seq
MIRT965789	hsa-miR-2278	CLIP-seq
MIRT965790	hsa-miR-3157-3p	CLIP-seq
MIRT965791	hsa-miR-3173-5p	CLIP-seq
MIRT965792	hsa-miR-329	CLIP-seq
MIRT965793	hsa-miR-330-3p	CLIP-seq
MIRT965794	hsa-miR-362-3p	CLIP-seq
MIRT965795	hsa-miR-3646	CLIP-seq
MIRT965753	hsa-miR-3660	CLIP-seq
MIRT965796	hsa-miR-3689d	CLIP-seq
MIRT965797	hsa-miR-3923	CLIP-seq
MIRT965798	hsa-miR-3941	CLIP-seq
MIRT965799	hsa-miR-4254	CLIP-seq
MIRT965800	hsa-miR-4308	CLIP-seq
MIRT965801	hsa-miR-4456	CLIP-seq
MIRT965802	hsa-miR-4457	CLIP-seq
MIRT965760	hsa-miR-4468	CLIP-seq
MIRT965803	hsa-miR-4494	CLIP-seq
MIRT965762	hsa-miR-4526	CLIP-seq
MIRT965804	hsa-miR-4642	CLIP-seq
MIRT965805	hsa-miR-466	CLIP-seq
MIRT965806	hsa-miR-4672	CLIP-seq
MIRT965807	hsa-miR-4731-3p	CLIP-seq
MIRT965808	hsa-miR-4789-5p	CLIP-seq
MIRT965809	hsa-miR-4801	CLIP-seq
MIRT965810	hsa-miR-495	CLIP-seq
MIRT965811	hsa-miR-499a-5p	CLIP-seq
MIRT965812	hsa-miR-587	CLIP-seq
MIRT965813	hsa-miR-603	CLIP-seq
MIRT965814	hsa-miR-617	CLIP-seq
MIRT965815	hsa-miR-628-3p	CLIP-seq
MIRT965816	hsa-miR-671-5p	CLIP-seq
MIRT965817	hsa-miR-874	CLIP-seq
MIRT1986095	hsa-miR-380	CLIP-seq
MIRT1986096	hsa-miR-4495	CLIP-seq
MIRT965735	hsa-miR-103a	CLIP-seq
MIRT965736	hsa-miR-107	CLIP-seq
MIRT965745	hsa-miR-297	CLIP-seq
MIRT965750	hsa-miR-3149	CLIP-seq
MIRT2220620	hsa-miR-3607-3p	CLIP-seq
MIRT2220621	hsa-miR-3973	CLIP-seq
MIRT2220622	hsa-miR-4426	CLIP-seq
MIRT2220623	hsa-miR-4647	CLIP-seq
MIRT2220624	hsa-miR-4662b	CLIP-seq
MIRT2220625	hsa-miR-4694-3p	CLIP-seq
MIRT2220626	hsa-miR-4711-5p	CLIP-seq
MIRT965764	hsa-miR-4729	CLIP-seq
MIRT2220627	hsa-miR-520g	CLIP-seq
MIRT2220628	hsa-miR-520h	CLIP-seq
MIRT965795	hsa-miR-3646	CLIP-seq
MIRT965745	hsa-miR-297	CLIP-seq
MIRT2387441	hsa-miR-3909	CLIP-seq
MIRT2387442	hsa-miR-410	CLIP-seq
MIRT2387443	hsa-miR-4436a	CLIP-seq
MIRT2387444	hsa-miR-567	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ERG	Activation	20860828

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005200	Function	Structural constituent of cytoskeleton	TAS	10783258
GO:0005737	Component	Cytoplasm	IDA	23664528
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	TAS	10783258
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0008092	Function	Cytoskeletal protein binding	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	23664528
GO:0010837	Process	Regulation of keratinocyte proliferation	IMP	23664528
GO:0031032	Process	Actomyosin structure organization	IBA
GO:0031032	Process	Actomyosin structure organization	IDA	22006950
GO:0042060	Process	Wound healing	IDA	23664528
GO:0045177	Component	Apical part of cell	IDA	22006950
GO:0045785	Process	Positive regulation of cell adhesion	IMP	23664528
GO:0051549	Process	Positive regulation of keratinocyte migration	IMP	23664528
GO:0070161	Component	Anchoring junction	IEA

MIM	HGNC	e!Ensembl
610340	19818	ENSG00000095203

Q9H329

Protein name

Band 4.1-like protein 4B (Erythrocyte membrane protein band 4.1-like 4B) (FERM-containing protein CG1) (Protein EHM2)

Protein function

Up-regulates the activity of the Rho guanine nucleotide exchange factor ARHGEF18 (By similarity). Involved in the regulation of the circumferential actomyosin belt in epithelial cells (PubMed:22006950). Promotes cellular adhesion, migration and

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09379	FERM_N	89 → 152	FERM N-terminal domain	Domain
PF00373	FERM_M	168 → 277	FERM central domain	Domain
PF09380	FERM_C	281 → 373	FERM C-terminal PH-like domain	Domain
PF08736	FA	379 → 420	FERM adjacent (FA)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at higher levels in acute wounds than chronic wounds with increased expression in healing wounds, especially at the leading wound edge (PubMed:23664528). Isoform 1 is highly expressed in brain. Isoform 2 is highly expressed i

Sequence

MLRFLRRTFGRRSMQRYARGAAGRGAAGLGDERDGGPRGGPAAAASSSALPAAPGGSVFP
AGGGPLLTGGAAVHISAAGAAKATLYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDL
VETDYFGLQFLDSAQVAHWLDHAKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYL
FVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAME
FDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFE
GANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSARTCKHLWKCAVE
HHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSR
RHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRWHPHSPNVSYPLPSPVLSS
SDRLPFGIEENGGTPFLTAASGRHHHQHQHQHQHQHHSNYSLSLTLENKEGPLRSPNSSS
KSLTKLSPGTPALFSEAAAHLKKLELETVKAAGPWPPLHININKAEEKKVSEKTLQTPLL
PSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQ
PAVEKPEIKPPRVRKLTRQYSFDEDDLPPDLAEAVGVTTSTTTNTTTAATQVSVPLPSPK
VQNVSSPHKSEGKGLLSPGAKSPSDRGGAFTLEPGDLLMDFTEATPLAEPASNPHCAHSR
CSPPLSLPMKEETTGVCMYPPIKTRLIKTFPVDTMNPFPDTFTTGPQFTADFRDSKLQCC
PGPTSPLIPAATLRPLTETVSTVQTIYTTRKPVSLAASAETLRQELEREKMMKRLLMTEL

Sequence length

900

Interactions

View interactions

	KEGG
	Tight junction

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY THROMBOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30816447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21047774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21047774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36422008	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17980240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30367317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37843347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37843347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL DOMINANT 5 (disorder)	Deafness	BEFREE	9450185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17980240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17980240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30367317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30816447	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21047774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30816447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16927306, 21047774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21047774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30816447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peroxisome biogenesis disorders	Zellweger Syndrome	BEFREE	11330042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16927306, 21047774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17280610, 20860828, 21047774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

EPB41L4B (erythrocyte membrane protein band 4.1 like 4B)