Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54556
Gene name	Inhibitor of growth family member 3
Gene symbol	ING3
Synonyms (NCBI Gene)	Eaf4ING2MEAF4p47ING3
Chromosome	7
Chromosome location	7q31.31
Summary	The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodelin

180

Show/Hide all (180)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043992	hsa-miR-378a-5p	CLASH	23622248
MIRT440455	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT440455	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT1066246	hsa-miR-1185	CLIP-seq
MIRT1066247	hsa-miR-129-5p	CLIP-seq
MIRT1066248	hsa-miR-1912	CLIP-seq
MIRT1066249	hsa-miR-298	CLIP-seq
MIRT1066250	hsa-miR-3125	CLIP-seq
MIRT1066251	hsa-miR-3126-3p	CLIP-seq
MIRT1066252	hsa-miR-3130-5p	CLIP-seq
MIRT1066253	hsa-miR-3616-5p	CLIP-seq
MIRT1066254	hsa-miR-3647-5p	CLIP-seq
MIRT1066255	hsa-miR-365	CLIP-seq
MIRT1066256	hsa-miR-3673	CLIP-seq
MIRT1066257	hsa-miR-3679-5p	CLIP-seq
MIRT1066258	hsa-miR-374c	CLIP-seq
MIRT1066259	hsa-miR-376a	CLIP-seq
MIRT1066260	hsa-miR-376b	CLIP-seq
MIRT1066261	hsa-miR-376c	CLIP-seq
MIRT1066262	hsa-miR-3916	CLIP-seq
MIRT1066263	hsa-miR-3924	CLIP-seq
MIRT1066264	hsa-miR-4433	CLIP-seq
MIRT1066265	hsa-miR-4477b	CLIP-seq
MIRT1066266	hsa-miR-4482	CLIP-seq
MIRT1066267	hsa-miR-450b-5p	CLIP-seq
MIRT1066268	hsa-miR-4635	CLIP-seq
MIRT1066269	hsa-miR-4641	CLIP-seq
MIRT1066270	hsa-miR-4652-3p	CLIP-seq
MIRT1066271	hsa-miR-4666-3p	CLIP-seq
MIRT1066272	hsa-miR-4690-3p	CLIP-seq
MIRT1066273	hsa-miR-4700-3p	CLIP-seq
MIRT1066274	hsa-miR-4719	CLIP-seq
MIRT1066275	hsa-miR-4726-3p	CLIP-seq
MIRT1066276	hsa-miR-4729	CLIP-seq
MIRT1066277	hsa-miR-4782-5p	CLIP-seq
MIRT1066278	hsa-miR-4799-5p	CLIP-seq
MIRT1066279	hsa-miR-494	CLIP-seq
MIRT1066280	hsa-miR-502-5p	CLIP-seq
MIRT1066281	hsa-miR-507	CLIP-seq
MIRT1066282	hsa-miR-516b	CLIP-seq
MIRT1066283	hsa-miR-518d-5p	CLIP-seq
MIRT1066284	hsa-miR-519b-5p	CLIP-seq
MIRT1066285	hsa-miR-519c-5p	CLIP-seq
MIRT1066286	hsa-miR-520c-5p	CLIP-seq
MIRT1066287	hsa-miR-526a	CLIP-seq
MIRT1066288	hsa-miR-557	CLIP-seq
MIRT1066289	hsa-miR-573	CLIP-seq
MIRT1066290	hsa-miR-590-3p	CLIP-seq
MIRT1066291	hsa-miR-634	CLIP-seq
MIRT1066292	hsa-miR-655	CLIP-seq
MIRT1066293	hsa-miR-877	CLIP-seq
MIRT1066294	hsa-miR-885-5p	CLIP-seq
MIRT1066295	hsa-miR-4803	CLIP-seq
MIRT2015881	hsa-miR-101	CLIP-seq
MIRT2015882	hsa-miR-103a	CLIP-seq
MIRT2015883	hsa-miR-107	CLIP-seq
MIRT1066247	hsa-miR-129-5p	CLIP-seq
MIRT2015884	hsa-miR-144	CLIP-seq
MIRT2015885	hsa-miR-1910	CLIP-seq
MIRT2015886	hsa-miR-3124-3p	CLIP-seq
MIRT2015887	hsa-miR-3163	CLIP-seq
MIRT2015888	hsa-miR-4313	CLIP-seq
MIRT2015889	hsa-miR-4469	CLIP-seq
MIRT1066267	hsa-miR-450b-5p	CLIP-seq
MIRT2015890	hsa-miR-455-3p	CLIP-seq
MIRT2015891	hsa-miR-4668-3p	CLIP-seq
MIRT1066276	hsa-miR-4729	CLIP-seq
MIRT1066281	hsa-miR-507	CLIP-seq
MIRT1066288	hsa-miR-557	CLIP-seq
MIRT2015892	hsa-miR-922	CLIP-seq
MIRT2015881	hsa-miR-101	CLIP-seq
MIRT2015882	hsa-miR-103a	CLIP-seq
MIRT2015883	hsa-miR-107	CLIP-seq
MIRT2015884	hsa-miR-144	CLIP-seq
MIRT2015892	hsa-miR-922	CLIP-seq
MIRT2430063	hsa-miR-1236	CLIP-seq
MIRT2430064	hsa-miR-337-3p	CLIP-seq
MIRT2430065	hsa-miR-410	CLIP-seq
MIRT2430066	hsa-miR-4753-3p	CLIP-seq
MIRT2430067	hsa-miR-4778-3p	CLIP-seq
MIRT2451836	hsa-miR-105	CLIP-seq
MIRT2451837	hsa-miR-1276	CLIP-seq
MIRT2451838	hsa-miR-3671	CLIP-seq
MIRT2451839	hsa-miR-4495	CLIP-seq
MIRT2451840	hsa-miR-4777-5p	CLIP-seq
MIRT2451841	hsa-miR-532-5p	CLIP-seq
MIRT2451842	hsa-miR-607	CLIP-seq
MIRT2015881	hsa-miR-101	CLIP-seq
MIRT2015882	hsa-miR-103a	CLIP-seq
MIRT2551912	hsa-miR-103b	CLIP-seq
MIRT2015883	hsa-miR-107	CLIP-seq
MIRT1066246	hsa-miR-1185	CLIP-seq
MIRT2551913	hsa-miR-1267	CLIP-seq
MIRT1066247	hsa-miR-129-5p	CLIP-seq
MIRT2015884	hsa-miR-144	CLIP-seq
MIRT1066248	hsa-miR-1912	CLIP-seq
MIRT2551914	hsa-miR-205	CLIP-seq
MIRT2551915	hsa-miR-21	CLIP-seq
MIRT1066250	hsa-miR-3125	CLIP-seq
MIRT1066252	hsa-miR-3130-5p	CLIP-seq
MIRT2551916	hsa-miR-3144-3p	CLIP-seq
MIRT2551917	hsa-miR-3157-5p	CLIP-seq
MIRT2015887	hsa-miR-3163	CLIP-seq
MIRT1066257	hsa-miR-3679-5p	CLIP-seq
MIRT2551918	hsa-miR-370	CLIP-seq
MIRT1066259	hsa-miR-376a	CLIP-seq
MIRT1066260	hsa-miR-376b	CLIP-seq
MIRT1066262	hsa-miR-3916	CLIP-seq
MIRT1066263	hsa-miR-3924	CLIP-seq
MIRT1066264	hsa-miR-4433	CLIP-seq
MIRT1066266	hsa-miR-4482	CLIP-seq
MIRT1066267	hsa-miR-450b-5p	CLIP-seq
MIRT1066270	hsa-miR-4652-3p	CLIP-seq
MIRT2551919	hsa-miR-4680-3p	CLIP-seq
MIRT1066272	hsa-miR-4690-3p	CLIP-seq
MIRT1066273	hsa-miR-4700-3p	CLIP-seq
MIRT2551920	hsa-miR-4717-3p	CLIP-seq
MIRT1066274	hsa-miR-4719	CLIP-seq
MIRT1066275	hsa-miR-4726-3p	CLIP-seq
MIRT1066276	hsa-miR-4729	CLIP-seq
MIRT1066281	hsa-miR-507	CLIP-seq
MIRT2551921	hsa-miR-513b	CLIP-seq
MIRT1066282	hsa-miR-516b	CLIP-seq
MIRT1066283	hsa-miR-518d-5p	CLIP-seq
MIRT1066284	hsa-miR-519b-5p	CLIP-seq
MIRT1066285	hsa-miR-519c-5p	CLIP-seq
MIRT1066286	hsa-miR-520c-5p	CLIP-seq
MIRT1066287	hsa-miR-526a	CLIP-seq
MIRT1066288	hsa-miR-557	CLIP-seq
MIRT2551922	hsa-miR-582-3p	CLIP-seq
MIRT2551923	hsa-miR-590-5p	CLIP-seq
MIRT2551924	hsa-miR-596	CLIP-seq
MIRT1066291	hsa-miR-634	CLIP-seq
MIRT2551925	hsa-miR-653	CLIP-seq
MIRT2551926	hsa-miR-664	CLIP-seq
MIRT2551927	hsa-miR-875-5p	CLIP-seq
MIRT1066293	hsa-miR-877	CLIP-seq
MIRT2015892	hsa-miR-922	CLIP-seq
MIRT2015881	hsa-miR-101	CLIP-seq
MIRT2015882	hsa-miR-103a	CLIP-seq
MIRT2015883	hsa-miR-107	CLIP-seq
MIRT1066246	hsa-miR-1185	CLIP-seq
MIRT1066247	hsa-miR-129-5p	CLIP-seq
MIRT2015884	hsa-miR-144	CLIP-seq
MIRT1066248	hsa-miR-1912	CLIP-seq
MIRT2551914	hsa-miR-205	CLIP-seq
MIRT1066250	hsa-miR-3125	CLIP-seq
MIRT1066252	hsa-miR-3130-5p	CLIP-seq
MIRT2551916	hsa-miR-3144-3p	CLIP-seq
MIRT2551917	hsa-miR-3157-5p	CLIP-seq
MIRT1066257	hsa-miR-3679-5p	CLIP-seq
MIRT2551918	hsa-miR-370	CLIP-seq
MIRT1066262	hsa-miR-3916	CLIP-seq
MIRT1066263	hsa-miR-3924	CLIP-seq
MIRT1066264	hsa-miR-4433	CLIP-seq
MIRT1066266	hsa-miR-4482	CLIP-seq
MIRT1066267	hsa-miR-450b-5p	CLIP-seq
MIRT1066270	hsa-miR-4652-3p	CLIP-seq
MIRT2551919	hsa-miR-4680-3p	CLIP-seq
MIRT1066272	hsa-miR-4690-3p	CLIP-seq
MIRT1066273	hsa-miR-4700-3p	CLIP-seq
MIRT2551920	hsa-miR-4717-3p	CLIP-seq
MIRT1066274	hsa-miR-4719	CLIP-seq
MIRT1066275	hsa-miR-4726-3p	CLIP-seq
MIRT1066276	hsa-miR-4729	CLIP-seq
MIRT1066281	hsa-miR-507	CLIP-seq
MIRT2551921	hsa-miR-513b	CLIP-seq
MIRT1066282	hsa-miR-516b	CLIP-seq
MIRT1066283	hsa-miR-518d-5p	CLIP-seq
MIRT1066284	hsa-miR-519b-5p	CLIP-seq
MIRT1066285	hsa-miR-519c-5p	CLIP-seq
MIRT1066286	hsa-miR-520c-5p	CLIP-seq
MIRT1066287	hsa-miR-526a	CLIP-seq
MIRT1066288	hsa-miR-557	CLIP-seq
MIRT2551922	hsa-miR-582-3p	CLIP-seq
MIRT2551924	hsa-miR-596	CLIP-seq
MIRT1066291	hsa-miR-634	CLIP-seq
MIRT2551927	hsa-miR-875-5p	CLIP-seq
MIRT1066293	hsa-miR-877	CLIP-seq
MIRT2015892	hsa-miR-922	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000786	Component	Nucleosome	IDA	27153538
GO:0000812	Component	Swr1 complex	IDA	24463511
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	14966270
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010485	Function	Histone H4 acetyltransferase activity	IDA	16387653
GO:0032777	Component	Piccolo histone acetyltransferase complex	IDA	14966270
GO:0035267	Component	NuA4 histone acetyltransferase complex	IBA
GO:0035267	Component	NuA4 histone acetyltransferase complex	IDA	14966270, 16387653, 27153538
GO:0042981	Process	Regulation of apoptotic process	NAS	14966270
GO:0043995	Function	Histone H4K5 acetyltransferase activity	IDA	16387653
GO:0043996	Function	Histone H4K8 acetyltransferase activity	IDA	16387653
GO:0043997	Function	Histone H4K12 acetyltransferase activity	IDA	16387653
GO:0043998	Function	Histone H2A acetyltransferase activity	IDA	16387653
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	27153538
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	14966270
GO:0046872	Function	Metal ion binding	IEA
GO:0046972	Function	Histone H4K16 acetyltransferase activity	IDA	16387653
GO:0051726	Process	Regulation of cell cycle	IMP	27153538
GO:0140002	Function	Histone H3K4me3 reader activity	IDA	16728974, 19154204
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	27153538
GO:2000779	Process	Regulation of double-strand break repair	NAS	14966270

MIM	HGNC	e!Ensembl
607493	14587	ENSG00000071243

Q9NXR8

Protein name

Inhibitor of growth protein 3 (p47ING3)

Protein function

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA intera

PDB

1X4I , 7ZMX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12998	ING	3 → 104	Inhibitor of growth proteins N-terminal histone-binding	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, heart, kidney, liver, lung, ovaries, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus.

Sequence

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREE
QMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILE
RRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDAS
KENTLGCRNNNSTASSNNAYNVNSSQPLGSYNIGSLSSGTGAGAITMAAAQAVQATAQMK
EGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSALMTTLTQNASSSAADSRSGR
KSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQVDWTYDPNEP
RYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK

Sequence length

418

Interactions

View interactions

	KEGG
	ATP-dependent chromatin remodeling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GESTATIONAL DIABETES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (78)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	31138034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19962781, 24712846, 24927342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	24927342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	24927342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	31752342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30428349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21692063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10626813, 25073741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25073741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24927342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24927342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	25613071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22550337	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21692063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16465410, 28454301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	25613071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	28603028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26705104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19437536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	24927342	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19437536, 19442116, 24927342, 28944862, 28954383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19437536	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28944862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	17634537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29465311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29465311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	17634537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28454301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	27956122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29047383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	15935570, 18081876, 20131318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	18081876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	18081876	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	BEFREE	12080476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18160212, 20043106, 22550337, 27741326, 28454301, 30804473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18160212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22550337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16465410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	15935570, 18081876, 20131318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	25528767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10626813, 23959073, 25073741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22550337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16465410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25189355, 26803516, 27305909, 28511652, 29381681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23864195, 25894376, 29855536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21692063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19437536, 19442116, 19935701, 23959073, 28427307, 28454301, 29047383, 29165044, 30660694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10072587, 19437536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29721153		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15748897, 17634537, 19935701, 30804473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16520380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16755297, 17634537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16755297	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	16755297	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10326867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	19888305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10072587, 12080476, 12928496, 15748897, 15935570, 16465410, 16488987, 17634537, 18081876, 18160212, 18998165, 19730436, 19935701, 19962781, 20131318 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	9516838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19962781, 24712846, 31640185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28720899, 29465311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	32827035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25190103, 30604867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29381681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	32015217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	31138034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25189355, 26803516, 27305909, 28511652, 29381681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26803516, 28403887, 28511652, 34439818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29381681	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	21124965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19962781, 24712846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	UNIPROT_DG	12080476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	18998165, 30804473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23864195, 25894376, 29855536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Timothy syndrome	Timothy Syndrome	BEFREE	27956122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tricuspid Valve Stenosis	Tricuspid Valve Stenosis	BEFREE	27956122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29721153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	27956122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21692063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ING3 (inhibitor of growth family member 3)