Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5454
Gene name	POU class 3 homeobox 2
Gene symbol	POU3F2
Synonyms (NCBI Gene)	BRN2N-Oct3OCT7OTF-7OTF7POUF3brn-2oct-7
Chromosome	6
Chromosome location	6q16.1
Summary	This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is

140

Show/Hide all (140)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT006355	hsa-miR-211-5p	Luciferase reporter assayWestern blot	21435193
MIRT024206	hsa-miR-221-3p	qRT-PCR	20516212
MIRT052422	hsa-let-7a-5p	CLASH	23622248
MIRT638419	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT638418	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT638415	hsa-miR-1256	HITS-CLIP	23824327
MIRT638414	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT638413	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT638411	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT638419	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT638418	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT638417	hsa-miR-4297	HITS-CLIP	23824327
MIRT638416	hsa-miR-5581-5p	HITS-CLIP	23824327
MIRT638415	hsa-miR-1256	HITS-CLIP	23824327
MIRT638414	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT638413	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT638412	hsa-miR-5096	HITS-CLIP	23824327
MIRT638411	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	22291592
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	22291592
MIRT442062	hsa-miR-5681a	PAR-CLIP	22291592
MIRT442060	hsa-miR-3153	PAR-CLIP	22291592
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	22291592
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	22291592
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	22291592
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	23708386
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	23708386
MIRT442062	hsa-miR-5681a	PAR-CLIP	23708386
MIRT442060	hsa-miR-3153	PAR-CLIP	23708386
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	23708386
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	23708386
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	23708386
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	22100165
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	22100165
MIRT442062	hsa-miR-5681a	PAR-CLIP	22100165
MIRT442060	hsa-miR-3153	PAR-CLIP	22100165
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	22100165
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	22100165
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	22100165
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	22100165
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	22100165
MIRT442062	hsa-miR-5681a	PAR-CLIP	22100165
MIRT442060	hsa-miR-3153	PAR-CLIP	22100165
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	22100165
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	22100165
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	22100165
MIRT734691	hsa-miR-590-3p	qRT-PCR	31484947
MIRT638419	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT638418	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT638415	hsa-miR-1256	HITS-CLIP	23824327
MIRT638414	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT638413	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT638411	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT638419	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT638418	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT638417	hsa-miR-4297	HITS-CLIP	23824327
MIRT638416	hsa-miR-5581-5p	HITS-CLIP	23824327
MIRT638415	hsa-miR-1256	HITS-CLIP	23824327
MIRT638414	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT638413	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT638412	hsa-miR-5096	HITS-CLIP	23824327
MIRT638411	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	22291592
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	22291592
MIRT442062	hsa-miR-5681a	PAR-CLIP	22291592
MIRT442060	hsa-miR-3153	PAR-CLIP	22291592
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	22291592
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	22291592
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	22291592
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	23708386
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	23708386
MIRT442062	hsa-miR-5681a	PAR-CLIP	23708386
MIRT442060	hsa-miR-3153	PAR-CLIP	23708386
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	23708386
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	23708386
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	23708386
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	22100165
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	22100165
MIRT442062	hsa-miR-5681a	PAR-CLIP	22100165
MIRT442060	hsa-miR-3153	PAR-CLIP	22100165
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	22100165
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	22100165
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	22100165
MIRT442063	hsa-miR-6816-3p	PAR-CLIP	22100165
MIRT442061	hsa-miR-6895-5p	PAR-CLIP	22100165
MIRT442062	hsa-miR-5681a	PAR-CLIP	22100165
MIRT442060	hsa-miR-3153	PAR-CLIP	22100165
MIRT442059	hsa-miR-6733-5p	PAR-CLIP	22100165
MIRT442058	hsa-miR-6739-5p	PAR-CLIP	22100165
MIRT442057	hsa-miR-6781-5p	PAR-CLIP	22100165
MIRT1250973	hsa-miR-1200	CLIP-seq
MIRT1250974	hsa-miR-129-5p	CLIP-seq
MIRT1250975	hsa-miR-1299	CLIP-seq
MIRT1250976	hsa-miR-219-2-3p	CLIP-seq
MIRT1250977	hsa-miR-3074-5p	CLIP-seq
MIRT1250978	hsa-miR-3123	CLIP-seq
MIRT1250979	hsa-miR-3126-3p	CLIP-seq
MIRT1250980	hsa-miR-3140-5p	CLIP-seq
MIRT1250981	hsa-miR-3606	CLIP-seq
MIRT1250982	hsa-miR-3667-3p	CLIP-seq
MIRT1250983	hsa-miR-3668	CLIP-seq
MIRT1250984	hsa-miR-3919	CLIP-seq
MIRT1250985	hsa-miR-3924	CLIP-seq
MIRT1250986	hsa-miR-4652-3p	CLIP-seq
MIRT1250987	hsa-miR-4756-3p	CLIP-seq
MIRT1250988	hsa-miR-4760-3p	CLIP-seq
MIRT1250989	hsa-miR-511	CLIP-seq
MIRT1250990	hsa-miR-579	CLIP-seq
MIRT1250991	hsa-miR-583	CLIP-seq
MIRT1250992	hsa-miR-664	CLIP-seq
MIRT1250993	hsa-miR-875-3p	CLIP-seq
MIRT1250994	hsa-miR-921	CLIP-seq
MIRT2074088	hsa-miR-4267	CLIP-seq
MIRT2074089	hsa-miR-4520a-5p	CLIP-seq
MIRT2074090	hsa-miR-4520b-5p	CLIP-seq
MIRT2301081	hsa-miR-125a-5p	CLIP-seq
MIRT2301082	hsa-miR-125b	CLIP-seq
MIRT2301083	hsa-miR-140-5p	CLIP-seq
MIRT2301084	hsa-miR-3180-5p	CLIP-seq
MIRT2301085	hsa-miR-331-3p	CLIP-seq
MIRT2301086	hsa-miR-3545-5p	CLIP-seq
MIRT2301087	hsa-miR-3670	CLIP-seq
MIRT2301088	hsa-miR-376c	CLIP-seq
MIRT2301089	hsa-miR-4319	CLIP-seq
MIRT2301090	hsa-miR-4460	CLIP-seq
MIRT2301091	hsa-miR-513b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SOX9	Repression	15896776

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7601453, 9482665
GO:0005515	Function	Protein binding	IPI	11029584
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	ISS
GO:0007420	Process	Brain development	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15024079
GO:0008544	Process	Epidermis development	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0014044	Process	Schwann cell development	IEA
GO:0021799	Process	Cerebral cortex radially oriented cell migration	IEA
GO:0021869	Process	Forebrain ventricular zone progenitor cell division	IEA
GO:0021897	Process	Forebrain astrocyte development	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0021979	Process	Hypothalamus cell differentiation	IEA
GO:0021985	Process	Neurohypophysis development	IEA
GO:0022011	Process	Myelination in peripheral nervous system	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	ISS
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042802	Function	Identical protein binding	IPI	11029584
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048663	Process	Neuron fate commitment	IEA
GO:0048663	Process	Neuron fate commitment	ISS
GO:0048665	Process	Neuron fate specification	IEA
GO:0048665	Process	Neuron fate specification	ISS
GO:0048666	Process	Neuron development	IEA
GO:0048666	Process	Neuron development	ISS
GO:0050770	Process	Regulation of axonogenesis	IEA
GO:0061101	Process	Neuroendocrine cell differentiation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
600494	9215	ENSG00000184486

P20265

Protein name

POU domain, class 3, transcription factor 2 (Brain-specific homeobox/POU domain protein 2) (Brain-2) (Brn-2) (Nervous system-specific octamer-binding transcription factor N-Oct-3) (Octamer-binding protein 7) (Oct-7) (Octamer-binding transcription factor 7

Protein function

Transcription factor that plays a key role in neuronal differentiation (By similarity). Binds preferentially to the recognition sequence which consists of two distinct half-sites, ('GCAT') and ('TAAT'), separated by a non-conserved spacer region

PDB

7XRC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00157	Pou	265 → 336	Pou domain - N-terminal to homeobox domain	Domain
PF00046	Homeodomain	355 → 411	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed specifically in the neuroectodermal cell lineage.

Sequence

MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQ
WITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHG
PGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPS
MGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPP
PPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYG
NVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTS
IEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP
GAEDVYGGSRDTPPHHGVQTPVQ

Sequence length

443

Interactions

View interactions

	Reactome
			EGR2 and SOX10-mediated initiation of Schwann cell myelination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
POU3F2-associated disorder	Likely pathogenic	rs1769989432	RCV001254102	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL AMYLOID ANGIOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POU3F2-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (50)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	26482608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23358112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32478689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	21915259, 27378147, 33539344	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21915259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	21915259, 30772379		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21915259		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	21915259, 24618891, 30545964, 30772379	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	33492284, 37596527	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	36791193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	7651733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21771320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	36978091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24601786, 24726434, 26020805, 27852622, 29773872, 30497369, 34282187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	26833329, 30199896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	36978091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32664164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	37207645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32664164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	Pubtator	16858508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	26833329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	23358112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25243889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27784708, 29396873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27784708, 9178889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11029584, 15024079, 15024080, 18829533, 18923447, 18996486, 21358674, 21435193, 22988297, 23069940, 26387540, 28119061, 28883623, 29781575, 29990501 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11029584, 14708619, 23069940, 30277012, 30804224, 32169117, 34958806, 38169586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15024080, 18996486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30545964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	8026890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	23173060, 7478537, 7651733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	25143124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31484947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25395235, 29781575, 7651733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15911144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26833329		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	37207645	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	27784708, 29396873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28285791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21771320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21915259, 30772379		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	21915259, 30545964, 30772379	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23358112, 23530560, 26482608, 8026890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31551362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35578189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	32664164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

POU3F2 (POU class 3 homeobox 2)